Recessional
by
James A Michener


BOOKS BY JAMES A. MICHENER

Tales of the South Pacific

The Fires of Spring

Return to Paradise

The Voice of Asia

The Bridges of Toko-Ri

Sayonara

The Floating World

The Bridge at Andau

Hawaii

Report of the County Chairman

Caravans

The Source

Iberia

Presidential Lottery

The Quality of Life

Kent State: What Happened and Why

The Drifters

A Michener Miscellany: 1950-1970

Centennial

Sports in America

Chesapeake

The Covenant

Space

Poland

Texas

Legacy

Alaska

Journey

Caribbean

The Eagle and the Raven

Pilgrimage

The Novel

The World Is My Home: A Memoir

James A. Michener's Writer's Handbook

Mexico

Creatures of the Kingdom

My Lost Mexico

Literary Reflections

Recessional

with A. Grove Day

Rascals in Paradise

with John Kings

Six Days in Havana

RECESSIONAL

JAMESA.MICHENER

Seeker & Warburg London

First published in Great Britain in 1995 by Martin Seeker & Warburg
Limited, an imprint of Reed Consumer Books Limited, Michelin House, 81
Fulham Road, London SW3 6RB and Auckland, Melbourne, Singapore and
Toronto Copyright (c) 1994 by James A. Michener Maps copyright (c) 1994
by Anita Karl and Jim Kemp Illustrations copyright (c) 1994 by Franca
Nucci Haynes The author has asserted his moral rights A CIP catalogue
record for this book is available from the British Library

ISBN 0 436 20280 8

Printed and bound in Great Britain by Mackays of Chatham PLC, Chatham,
Kent

Recessional: noun.  A hymn or other piece of music played at the end of
a service while the congregation is filing out.

ARRIVALS

ON THE LAST DAY of the year, when an icy blizzard shrieked in from Lake
Michigan to cover Chicago in a coating of sleet, it struck with
particular fury at Boul Mich, the handsome thoroughfare that displays
the best of the Windy City.  Here stood the enormously rich Art
Institute, the great hotels to which Middle America came to participate
in metropolitan life; businessmen and -women came to visit banks and
centers of commerce, shoppers to patronize the elegant stores, others
to enjoy the fine museums.

Michigan Boulevard was the official name of the spacious promenade, but
early Chicagoans, deeming their city the equal of any in Europe, had
informally christened their major street Boul Mich in the French style,
and the name had stuck.  In summer the long stretches that faced the
lake, with only parkland between the boulevard and the water, seemed
almost rural, but on this dark December morning, with the blizzard
whipping in, Boul Mich was a formidable place that only the brave dared
challenge.  Sleet had encrusted everything, its scintillating gleam
rivaling that of the jewels on display in the shop windows.  It lay so
heavy on the boulevard, and was accompanied by such a powerful blast
from the lake, that ropes had been strung between poles to enable
pedestrians to crawl along without being blown into the storefronts or
out into the traffic.

Some hardy men seemed to revel in the hazards of the storm, striding
purposefully along as if impervious to the menace underfoot, but even
they, when a gust roared in without warning, were quick to grasp at the
protective ropes and edge their way along.  Women, their coats and
dresses whipping about their knees, retreated to the safe streets that
ran parallel to Boul Mich but inland from the lake-Wabash, State or
Dearborn-where walking became easier with careful navigation of the
sleeted pavements.

At half after nine on this wintry morning a slim young man in his
middle thirties worked his way carefully southward along Boul Mich.

When he tried to negotiate the Monroe cross street he was driven so far
to his right that he found himself completely off the boulevard, but
with extra effort he worked his way back, relieved to find himself
protected by the massive bulk of the Art Institute.

"I never visited you enough," he apologized to the entrance as he
paused to catch his breath, 'and now I won't have the chance.  Damn."

With renewed strength he left the protection of the museum.  Pulling
the lapels of his overcoat more tightly about his throat, and holding
them there with his right hand, he managed to cling to the rope with
his left and work his way along the boulevard to Van Buren and then to
Congress, where the line of luxury hotels began.

By the time he reached the Sparkman Towers he was so exhausted that he
did not enter like a normal guest through the main entrance but allowed
the wind to push him through the small side door, the only one kept
open during such storms.  Safely indoors, he dropped momentarily into
an upholstered chair to regain control of his heartbeat and breathing.
Taking his pulse as he always did after heavy exertion, he noted with
satisfaction: a hundred and ten dropping rapidly to good old eighty.
After a few minutes, he felt ready for the crucial meeting he had come
for, but before he could find the receptionist, he was accosted by the
hotel doorman, who had been sensible enough to move his workstation
inside and away from the blizzard.

"Pretty bad out there?"  He was a jovial fellow in his fifties,
overweight but also over endowed with Irish charm and a winning smile,
the kind of man who created the impression that he took pride in his
work.

"It's a gangbuster.  If they hadn't strung the ropes, I'd never have
made it."

"And who might you be coming to see on a morning like this?"

"John Taggart.  I believe he's expecting me."

"On a Saturday morning like this?"

"I suspect he's as eager to see me as I am to see him, storm or no
storm."

"And who can I say wants to see him?"

"Andy Zorn.  Dr.  Andy Zorn."

"A medical doctor?  Don't tell me you make house calls."

"Only on nice days like this when I enjoy the walk."

The doorman led the way to the small, handsomely decorated table that
served as the reception desk.

"Dr.  Andy Zorn to see Mr.  Taggart.

Says he has an appointment."

"He does indeed," the young woman in the trim business suit said.

"Mr.  Taggart called a few minutes ago.  Said he was expecting you but
he doubted you could make it in this storm.  Said to bring you right
up, Dr.

Zorn."  She accompanied him to the bank of eight elevators, choosing a
reserved one for which she had a special key.

John Taggart, a major Chicago investor in retirement centers across the
country, maintained both his living quarters and his office, two
different sets of rooms, on the twenty-third floor of the Towers.  The
door to his apartment contained only its number, 2300; his office
carried no number at all, only a small brass plate affixed to the wall
engraved with elegant letters so small they could scarcely be read from
a distance: JOHN TAGGART ENTERPRISES.

The receptionist did not knock on the office door but entered as if the
place was familiar, leading Zorn to an inner sanctuary.  Behind a large
white-oak desk sat a fifty-year-old man in an elegant exercise suit:

heavily ribbed gray turtleneck sweater and fitted trousers in a gray
one shade darker.  Surprisingly, he wore about his forehead a rough
terrycloth sweatband, which he did not take off as he rose and extended
his hand to welcome Dr.  Zorn.

"When I looked out this morning and saw the blizzard I said: "He won't
make it today," and went down to the gym for my workout."  He pressed
his hands proudly over his flat stomach.

"But it was essential that I see you," Zorn said as Mr.  Taggart
accompanied the receptionist to the door and said: "Thank you so much,
Beth, for bringing him up."  Turning back to Zorn, he said: "Yes, it is
important, isn't it?  For both of us."

For the next moments Taggart simply stared at his visitor.  The vacancy
in his huge organization was of supreme importance, and the new manager
would have to be a youngish man of exceptional abilities.

Tampa was the flagship of Taggart Enterprises, but it was foundering.

What Taggart saw in his inspection of a man he had not previously met
was a doctor of thirty-five, medium height, not overweight, in apparent
good health and distinguished by two attractive qualities: he had a
healthy crop of brick-red hair, which looked as if it ought to be
accompanied by a face full of country-boy freckles, and a roguish smile
that signaled: I don't take myself too seriously.  Taggart knew that he
had been a successful medical doctor of great ability who had fallen on
bad times and had left his profession.  Zora was available to direct a
major health institution and Taggart wanted to hire him, but needed to
know what kind of man he was after the buffetings he'd taken.

Indicating that Zorn should take the preferred seat, the one that
looked out on Lake Michigan, he said: "Have you had breakfast?"

When Zorn nodded yes, he said: "Good.  So have I, but I'll bet we could
each profit from some fresh-squeezed orange juice."  Pushing a button
on his desk intercom, he ordered the drinks, and before they arrived he
went directly to the heart of the problem that had brought them
together.

"We need each other, Zorn.  From what my men tell me, I judge that
you're fed up with Chicago-especially on a day like this."

"Maybe better said, Chicago's fed up with me."

"Could be."

When the orange juice arrived, Taggart took the glasses from the waiter
and personally served his guest, then returned to his chair behind the
desk and sat staring at his own glass.  Holding his hands together, he
lifted his elbows parallel to the floor and flexed his muscles three or
four times in an isometric exercise that ended with his pulling his
extended fists sharply back and into his chest, as if he were trying to
knock himself out.  He then took a long drink.

"Dr.  Zorn.  You were on your high school track team.  Always good for
a man to have been an athlete.  Teaches him about winning."  He stopped
to stare directly at the doctor: "And the game I'm in and which you
seek to join is about how we win, and why others lose, and how we turn
their losses into our wins.  It's about nothing else-not money, not
health, not retirement.  It's about winning, and don't you forget
it."

He led Zorn to an alcove whose walls were lined with charts and
displays that summarized Taggart Enterprises.  One wall was dominated
by a huge aerial photograph of a cluster of buildings surrounded by
well-kept real estate, another by a large map of the United States
decorated with more than fifty stick pins, each ending in a glass bead
in one of three colors-red, blue, black.  They were well dispersed
across the United States but seemed a bit more heavily concentrated in
New England and the areas adjacent to Seattle.

"How many, do you judge?"  Taggart asked.

"Well over fifty."

"Eighty-seven.  And do you notice how they're differentiated?"

"I see the three colors.  Am I missing something?"

"How about the three forms to the pins?"  and when Zorn looked more
closely he saw that regardless of the pin's color, its head could be
either round or square or triangular.

"What you see summarized here is our entire operation.  If you're to
work with us, you must make yourself familiar with it, especially the
physical forms, which aren't so easy to see or understand."  Picking up
a handful of pins from a tray on the table, he handed them one by one
to Zorn as he explained: "Square, we own the entire operation, we bear
the loss, we bank the profit.

Round, we own the place fifty-fifty with local financiers.  Triangle,
local people own at least ninety percent, we own ten or less, but they
give us a profitable managerial contract."  He paused, then tapped his
desk as he slowly enunciated each word, 'for-as-long-as-we-show-
aprofit."  Leaning back, he stared at Zorn again: "Three months' losses
in a row, they can abrogate the contract-and they do."

Juggling the remaining pins in his hand, he asked: "What have I just
told you?"  and Zorn apparently pleased him with his short reply: "You
own some outright.  You're co-partners on others.  You have only a
managerial contract on others."

"That isn't what I said."

Zorn, well aware of the shortcut he'd taken, said: "Even on the
triangles you do retain a small ownership interest."

"Now, why do you use that word retain1?  I didn't say retain."I "I
suppose you either build the installation or supervise it, then pass
the ownership off to the local investors."

"You catch on, Doctor, but the headaches keep us awake at night.

Black means that regardless of who owns the installation, it shows a
good profit.  Blue means it's paying its way but not handsomely and
often just barely.  Red, as I'm sure you've guessed, means an actual
loss at the end of the month and maybe even the quarter."

"You do have some reds, but they're safely scattered."

"What do you mean by that?"

"Reassuring.  It means an entire area isn't in trouble.  Only the
poorly run job."

The governing master of Taggart Enterprises-which was worth a total of
about three hundred and fifty million-now seemed to lose interest in
the statistics of his empire; his real concern was with the
intellectual aspects of his vast operation and, more specifically, the
functioning of each individual unit.  Lowering his voice as if what he
was about to say cut to the heart of a possible Taggart-Zorn
partnership, he took from another part of the table three wooden blocks
of descending size.  Pushing the biggest in front of Zorn he said:

"Everything up to now has been pleasantry.  Now we come down to
reality.  Each of our centers consists of three vital parts, each as
important as the other two.  Your job is to keep the three segments in
balance, because only then do we make any profits."

Tapping the biggest block, he said: This big one looks to be the heart
of our effort.  It represents the big building in which ordinary people
in good health have retired for traditional retirement living.

One solid meal a day, or perhaps two or three according to which plan
they've chosen.  Expensive but a bargain because it's assured and
orderly.  Costs out to the resident at about twenty-two thousand a year
after their buy-in.  This next block, somewhat smaller, is the Assisted
Living center, available for when you break a leg, or need an
operation, or require care in dressing and feeding yourself.  Maybe two
thousand dollars a month."  Pushing the middle block toward Zorn, he
said: This is the one that will give you trouble.  How to keep it
filled?  A very difficult task, because we've legally promised the
people in the big building that they are assured entrance to Assisted
Living whenever needed.  So you must keep eight or ten beds constantly
available for our own people.  But then you must fill the remainder
with sick people we bring in off the street-at a good profit-and
sometimes for protracted stays."  Tapping the middle block, he asked:
"Do you appreciate what I'm saying?  Managing Assisted Living is a
juggling act that some of our managers handle magnificently.  I'm
considering hiring you to manage the Palms, our flagship, a handsome
center in Tampa, Florida, because I have reason to believe that you're
bright enough to manage this Assisted Living block and help us show a
profit."

Almost offhandedly he shoved the smallest block into position and
dismissed it quickly: "Extended Care, where an extraordinary mix of
dying people come or are brought by their families to end their lives
in decency and with whatever relief from pain we can provide."

"A hospice?"  Zorn asked and Taggart frowned: "We never use that word,
or allow anyone associated with the center to use it.  It's ugly,
frightening and reeks of death."

"I judge from the way you've been speaking that you find it fairly easy
to keep it filled."

"Yes.  It provides a crucial service.  Sick people need it.  Families
need it.

It earns us real money."

Grasping the three blocks, he formed them into an orderly unit and
said: "Your three blocks must work together, but they are in a sense
separate.  Of a hundred normal people living in the retirement area, a
few will move to Assisted Living, and of these a few will progress to
Extended.  A beautiful, Christian way to close down a life, an orderly
way to meet what we all must meet, sooner or later, death-our own
death, the death of our spouse, the death of our parents."

Touching each of the blocks, he smiled at Zorn: "Have you noticed
anything about the blocks, Doctor?"

They're black."

"And that means?"

"They earn a profit."

"Hopefully they do."

Taggart stepped back.

"Dr.  Zorn, our people have talked to you only in generalities.  I'm
betraying no secret when I confide that they've given you the highest
marks.  We want you, and we want you for a specific spot, a difficult
one.  Look at it."  He pointed on the map to the area around a red pin
with a square top indicating one of Taggart's major holdings.

"What does the pin tell you?"

The square says you own one hundred percent.  The red says you're
losing money-your own money."

"And what else?"

That if I'm sent there the losing red has to to turn into the
profitable black-or else."

Taggart grinned delightedly and raised one muscled arm to hug the
doctor's shoulders: "You're ready for the big time, and I'm convinced
you can do it."

Returning to his desk, he found what he wanted: "It was this
confidential report from one of your associates that alerted us to the
fact that you might have something we need: "Andy was an obstetrician
in

our clinic, and his responsibility ended with the successful
delivery of the baby.  But he loved children so much that he used to
wander over to our pediatrics wing to check up on what he called 'my
children."  He was deeply wounded when the parents of two of those
children sued him for malpractice, years after the births.  He left us
shortly after that."  ' Taggart said: "If you can express comparable
regard for older people, you'd be invaluable to us."  He then suggested
that they return to the more spacious outer office, where he ordered
soup and sandwiches to be brought in.  While they waited the two men
studied the storm-tossed lake, and Taggart said: "Usually by noon a
blow like this subsides.

What time is it?"

"Eleven-twenty."

"In forty minutes, watch.  The blowing sleet will vanish."

When the soup and sandwiches appeared with two glasses of skim milk and
two containers of strawberry yogurt, the men began a tasty, nutritious
lunch.  Taggart said: "I got started in the health business giving
lectures on the virtues of whole-wheat bread, skim milk and yogurt. The
philosophy behind these lectures is still the basis of my empire."

As they ate, Taggart said: "If you listened closely just now, I did not
actually offer you a job.  I said you seemed to be qualified.  At this
stage you know a great deal about me, or at least my operations, but I
don't know enough about you.  Are you ready to field some direct
questions?"

"I want this job.  Shoot."

"What are the facts about your two lawsuits?"

"I helped a woman give birth to a fine, normal, no-complications son.
Five years later something went wrong with the boy, and she hired a
lawyer who convinced the jury that five years earlier I had failed to
perform properly.  No evidence, just persuasive guesswork."  He winced
remembering the case: "Jury found me guilty, big award to her and a
warning from my insurance company that I was under surveillance."

The second?"

"Same lawyer, but this time the time span was eight years.  He proved
I'd been deficient, won a big award and my insurance company wanted to
cancel my policy.  When I begged them to keep me on their rolls, they
tripled my yearly fees, and I said: "To hell with it!"  and that's when
I applied to your people."

"Are you sorry to be giving up your practice?"

"Heartsick.  I was meant to be a baby doctor, and I was a good one.

But when shyster lawyers can twist the truth and your best work becomes
your worst enemy-enough."

"Were you good at doctoring?"

"Yes.  Ask the five others, obstetricians and pediatricians, who were
part of our little clinic."

"We did.  They agreed that you were first-class.  Didn't want to see
you leave."  Taggart looked at some papers he had brought to the dining
table and asked: "When I used the phrase "good at doctoring" I meant
also "good at handling the business details."  That would be important
to us."

"Did my team tell you that they chose me to run the business details of
our clinic?"

They did," Taggart said.

"I wanted to get a complete picture of your own commitment."

"It's intense, Mr.  Taggart.  I despise failing.  I like to keep things
in order."

Taggart obviously liked this response, but other questions remained:

"Did the lawsuits embitter you so much that you'd have trouble working
cooperatively with other people?"

Zorn almost lost his temper but at the last moment modified his voice
and said softly: "Screw the lawsuits.  Screw the insurance company.  I
applied to you for a job because I'm fully prepared to start over."

"Do you mean that, or are you just saying it?"

For the first time since he left his miserable hotel room to brave the
blizzard, Andy Zorn smiled, then chuckled and then laughed: "Mr.

Taggart, I'm aware that if you get me you get a twofer  A man you can
refer to in your ads as "our resident physician," and also a fellow who
can run an orderly shop.  Two for the price of one.  You'd be crazy if
you didn't grab me, and from this conversation I know we can work
together."  The smile, the laughter transformed him.  He was no longer
just a thirty-five-year-old doctor who had been sorely battered by the
courts; he was a lively, sharp-witted man in maximum possession of his
powers, and obviously a highly skilled physician whom Taggart liked
increasingly.

Andy, leaning back and looking out a different window, which

R E CESSION AL

revealed the inner heart of Chicago where he had established his
clinic, said reflectively and without animosity: "It's really
bewildering, that our society will allow or even encourage an
unprincipled system to drive young doctors like me out of a field like
obstetrics where we're so badly needed.  Right here in Chicago six men
about my age have simply quit.  They're either leaving medicine
altogether or qualifying themselves for other specialist fields.  Many
women can't find a baby doctor.  What a hell of a way to run a medical
system-through fear, and lies, and perjured testimony."

"I had your two cases carefully researched, Andy.  Being in the health
business we couldn't run risks.  The evidence against you was
perjured.

The judge was biased in everything he did.  And the jury awards were
scandalous.  I think you're wise to quit."  But then his voice changed
again: "Your divorce.  I hear it was rocky."

"She had her reasons.  The fault was mainly mine.  I had my eye only on
the success of our clinic."

There are good divorces and bad divorces.  I've been there myself.

And the good ones are those that explode in venom.  It proves they
ought to occur."

"Classify mine as good."

"Did it leave you hating women?  You mustn't take the job in Florida if
you despise women.  Two thirds of your clientele will be widows."

"When the monkey climbed off my back, he didn't take my brains with
him."

"Will you marry again?  We find that our managers do better if they're
married."

"Too soon.  But I'd never rule it out."

Suddenly Taggart became the philosopher of the retirement profession:
"We have solid statistics from our centers.  Men aged seventy who come
into our system with a wife live an average of three years longer than
grouchy widowers."  He fell silent for a moment, then said gravely: "I
suppose you know that the kinds of questions I've been asking are
illegal.  A potential employer is not allowed to probe so personally
when considering someone for a job."

"We were warned about that at the clinic.  Race, religion, marital
status, all verboten.  But for a job like the one you're considering me
for, if you didn't ask you'd be delinquent."

"So I have your permission?"

"Shoot.  I want the job."

Taggart shuffled some papers, studied one, and said: "Could you tell me
something about your family background?"

"Mother's a sentimental Irish Catholic from County Kerry.  Dad's a
tough-minded German Lutheran from Swabia."

"How do they get along?"

"Famously.  You'd like them.  Mom named me after two Catholic saints,
Mark Andrew, but Pop insisted on calling me Andy.  I graduated from
college under that name and also took my doctor's degree with the same.
It's my name."

"And where does that leave you?"

"Religiously?"  Zorn considered this improper intrusion for some
moments, then said simply: "I strive to be a moral man-a Christian."

Taggart reached out a paw like right hand: "Andy, you have the
job-director of the Palms.  I can't see any chance of your failing.
Your salary will be sixty-five to start, and the month you report that
you've turned red to black, you get a raise."

"Whom do I report to in Tampa?"

"Kenneth Krenek, our number two man.  He's been in charge during the
transition."

"Is he going to resent my arrival?"

"Ken?"  Taggart leaned back and a beatific smile covered his big
face:

"Ken Krenek is a teddy bear.  Lovable guy, born to play second
fiddle.

Oppose you?  Dr.  Zorn, Ken has phoned me constantly: "When do we get
our new manager, Mr.  Taggart?  We're waiting."  He's hungry for you to
take over, so he can avoid making important decisions."

"What's he like?"

"About my age, crop of sandy hair that makes him look like a little
boy, pudgy and with an optimism that can't be defeated.  Make him your
man and maybe the three of us-you, him, me-can turn our Tampa center
around."

"It'll mean a great deal to me.  Being a real doctor again."

Taggart frowned and got to his feet, their lunch completed.  Taking
Andy by the arm, he led him to a couch where they could sit side by
side: "Now we come to the difficult part, Andy.  My aides were not
authorized to discuss this matter, but I must.  We won't be hiring you
to be the medical doctor at the Palms, even though you are a doctor.
And we don't want you to take any exams to qualify for your license

in Florida.  You're to be our director and officer in charge of
medical services, nothing more.  We need you to give our operation down
there a touch of class: "Dr.  Zorn in charge of our medical
facilities."  But if a resident needs an aspirin or sprains a finger,
you don't even look at the problem.  You refer the patient to a local
physician."

"Even in Assisted Living and Extended Care?"  Zorn replied, trying to
hide his disappointment.

"Especially there, and for a reason you'll appreciate.  It's obligatory
that we stay on the good side of the local doctors, because they're the
ones who advise patients who need help to enter our two health
centers.

Always keep in mind that more than seventy percent of our patients in
those two units come in off the street.  And more than seventy percent
of our profits that enable us to keep the whole complex going come from
them."

"Then why do you bother with the retirement center?"

"Because it gives us prestige.  And for another damned good reason.

Across this nation, outfits that run only nursing homes do a lousy job,
treat their patients inhumanely, and ultimately go broke.  We've proved
in eighty-seven instances that the ideal mix is people in their sixties
and seventies coexisting with older ones in their eighties and
nineties.  One group helps inspirit the other, one helps pay for the
other."

As the men watched the storm below it behaved as Taggart had predicted:
at a quarter to twelve the blizzard abated, the sleet stopped, the
streets below became passable and even Boul Mich along the lake front
seemed becalmed.

"I'm glad to see that," Zorn said.

"I planned to leave Chicago this afternoon.  Have my little trailer
packed."

To drive where?"

"Wherever you sent me."

"You knew I'd hire you?"

"Yes.  I have a great deal to offer you, Mr.  Taggart."  Again, that
three-step process: a smile, a chuckle, a laugh: "But I never dreamed I
was to be a doctor without a medical kit," he added ruefully.

"The lawyers made that decision for you.  When I learned of your plight
I determined to use you at your maximum capacity.  Besides, at the
Palms you'll have little use for your obstetrical skills.  Average age
of our women guests, seventy-two."  When Andy laughed, Taggart asked:
"Are you starting your drive south now?  On these icy roads?"

"Look.  Traffic's resumed.  On the main highways I'll be using, the
sleet will be gone by one o'clock because the big trucks will melt it
off.  A doctor like me who drives a lot does appreciate those big
trucks that clear the way for us."

He intended leaving at this point, but Taggart detained him a few more
minutes, going back to the alcove, where he picked up the three blocks.
Returning with them he said: "Your job will be to keep these three
properly in the air."  And as he tossed aloft first one block then
another he said: "Retirement, Assisted Living, Extended.  Keep them in
balance and always heading up," and with that he juggled the blocks
adeptly, keeping them all in the air at the same time while Andy
promised from the elevator: "I'll try."

When Andy returned to the miserable hotel to which he had moved after
the closing of his medical practice and the settlement of his divorce,
he went to the desk, closed out his account and said good-bye to the
kindly proprietress, who had looked after him.  He then went out into
the parking lot to check for the third time the condition of the
intricate coupling that would hitch his rented trailer to his sedan,
one of the few things left him after his divorce.  As meticulous in
such mechanical matters as he had been in his medical practice, where
he left nothing to sudden unprepared decisions, he kicked each of the
six tires that must carry him to Florida and concluded that they were
properly inflated: On icy roads it's better to be just a little soft.
Gives better traction.

Taking his place in the driver's seat, he announced aloud: "Here we
go."  Gingerly he eased his tandem out of the icy parking lot and onto
wide Jackson Boulevard, where traffic had already cleared off most of
the sleet.  He drove cautiously eastward to Lake Shore Drive, which
would also be fairly clear of ice, and as he was about to turn right
into its growling traffic he had a moment of exhilaration comparable to
those he had known as a boy when starting an important trip: "How
appropriate!  My map shows that the moment I get my wheels on old

Route 411 stay on it and never turn left or right, straight to
Tampa and my new home.  Route 41, here I come!  Be good to me."

The plan he had worked out hastily when he learned that he would be
working in Florida required him to make Evansville, Indiana, this first
night.  It would be a drive of nearly three hundred miles, but since
his days in high school he had been accustomed to covering five or six
hundred miles a day and doing it alone if other young men in Denver had
not been free to go along and share the driving.  In those exciting
days when he was fanning out to places like Seattle, Los Angeles and
Chicago, if he did have to drive alone he did so until he felt the
first signs of fatigue.  He would then pull off to the side of the
highway, lock all doors and roll up all the windows except for a little
crack up front, and sleep crammed sideways for a couple of hours,
awaking with such renewed energy that he tore along the next portion of
his trip.  He had formed the habit of using a motel only on the third
night, when he judged that his body deserved total relaxation in a
proper bed.

Always a careful driver, he now tested the road that had been so
heavily battered by the blizzard and found that his tandem responded
properly when he applied the brakes, slowing to thirty or even twenty
without excessive yawing.  This is quite doable, he thought. Evansville
well before midnight without straining the engine.

When he reached the sign that said YOU ARE NOW ENTERING INDIANA he
saluted and cried: "Chicago, farewell!"  Then he made an obscene
gesture and added: "Up your bucket."  He was on his way to Florida.

But he was in Indiana only a few moments when he impulsively pulled off
the highway, stopped his rig, and put his face in his hands.

All bravado gone, he mumbled: "I lost a paradise in Chicago.  A great
job-one of the best clinics around.  And the wonderful mothers and
babies relying on me, trusting me.  A growing bank account and a
beautiful wife.  How did it all vanish so soon?"

Remaining frozen at the wheel, he pressed his temples and muttered: "A
doctor without a kit.  A specialist without a practice.  No wife, and
exactly a hundred and eighty dollars in my pocket.  Zorn, you sure
screwed up your life."

Then he suddenly tensed and his grip on the wheel tightened: Now,
dammit, start rebuilding, or your life will begin to go downhill right
now.  By some miracle I'm getting a second chance.  I'm earning good

money, and-who knows?-maybe someday I'll even practice as a doctor
again.

He restarted his motor, edged his rig back onto the highway and swore:
"Start of a new year, start of a new life."

Fifty miles farther south on Route 41 all ice on the highway had been
crushed and removed by heavy trucks, so that he felt safe in driving at
sixty miles per hour.  Even so, he kept careful watch on the car two
ahead to make sure that if anything happened he would be able to slow
down instantly.  With the extra load in the trailer pushing him from
behind, he must avoid sudden stops.

Daylight was disappearing by the time he reached the cutoff for
Interstate 65 that would sweep him around Terre Haute and put him on
the road for the finishing kick into Evansville, where he felt
confident that a motel bed would be waiting since the storm had kept
traffic from the interstates.  When it became clear that he would reach
his destination well before midnight, he relaxed, leaned back in his
seat, listened to the various FM stations as he entered their broadcast
range and sang along when they played some song he knew.

As he had expected, the first Evansville motel he approached had a
room, and for thirty dollars he had a hot bath, a good sleep and
complimentary coffee, so that when he headed south on New Year's
morning he had abundant energy.  Ahead of him was a reasonably clear
road and only four hundred miles or so to Atlanta.  But as he
approached Nashville on his run across Tennessee, he heard on his
radio: "Motorists are advised to proceed cautiously on the hilly
portions of Route 41 between Nashville and Chattanooga.  Icy conditions
prevail as a result of last night's storm.  Slow down!"  He chuckled at
the warning, thinking: Till you've been on Boul Mich with the ropes in
place to keep you from being blown away, you don't know what ice is.

Nevertheless he did slow down, for in recent years he had seen
television news showing in sickening detail how, in an ice storm or a
heavy fog, even cautious drivers could pile their cars into massive
crashes on the freeways.  He remembered one in California-sixty cars,
smashing into each other.

But even at his diminished speed, as he came around a bend in the hill
country just west of Chattanooga he saw the car two ahead start
slipping sideways and then, completely out of control, make a 180 
degree turn so that it continued sliding, but backward.  And as he
watched in terror, the doomed car moved slowly but inexorably into a
tangle of three others that had slid the same way, ending up in a huge
pileup involving scores of cars.  Cars heading west along the other
side of Highway 41 were also piling up, with some crossing the median
and smashing into the fronts of cars in his lane.

In the same moment that Andy realized he was in danger, he also saw a
possible escape route: off to the right of his side there was a
moderate berm that sloped gently down.  Convinced that he would surely,
within the next few moments, crash into the pile ahead and at the same
time be struck from behind, he wrenched his steering wheel sharply
toward the berm, thinking to drift down the slope.  His front wheels
did not respond, and he continued moving relentlessly toward the
pileup.  Reversing direction for just a moment, he quickly swung the
wheel back to the right, and this time, dangerously close to striking
the car ahead, his sedan and its heavy trailer eased gently over the
side of the road and slid slowly off the shoulder and down the bank,
escaping disaster.

But from his safety spot off the road he now watched the horror
occurring on the highway a few yards above him, much worse now than
anything he had ever seen on the news.  A monstrous double trailer
hauled by a massive six-wheel semi-the entire rig must have been eighty
feet long-moved ponderously down the far side of the road, lost control
and jackknifed into the eastbound cars, smashing some of them flat. His
mouth agape, he mumbled: "Jesus!  Just where I'd have been," but as a
doctor he felt urgently that he should not be a mere spectator down
below but up there in the midst of the carnage, helping to save
lives.

Before he could start crawling up the berm, he was immobilized by what
he saw developing to the east where a huge truck hauling two tiers of
new cars was approaching at considerable speed.  Men who had left their
smashed cars ran back along the highway, screaming at the driver: "Slow
down!  Slow down!"  but since he could not see the chaos ahead, he
interpreted their frantic signals as those of frightened strangers who
did not know how to drive Tennessee highways in bad weather.  Instead
of slowing down, he accelerated even more in order to maintain control
of his gigantic rig.  Zorn, seeing him speed up, recalled a term from
high school physics: "Christ, the kinetic force of

that bastard!"  He knew that the total forward thrust of that great
monster, its massive gear in back and its full load of new cars, could
plow through a stone wall before its force abated, and he screamed "No!
No!"  as it rammed into the huge trailer whose components now lay on
their sides with touring cars crushed beneath them.  With a thundering
crash the skidding car transport tore through the fallen semi,
continued over it and burst into flames, igniting the semi as well.

The people trapped in the cars below would be cremated.

Appalled as he watched from a safe distance of ten yards, the helpless
doctor remained immobilized.  To rush into that inferno hoping to save
lives would result only in the loss of his own.  As he climbed up the
berm to see what he might still be able to accomplish, he saw a sports
car driven by a young woman duplicate his performance by sliding slowly
toward the chaos.  Unlike him she found no avenue of escape.

Crashing with some force into the three late arrivals that had piled up
in the wake of the burning truck, she was obviously infuriated by a
mishap for which she shared no blame.  Climbing out of her damaged
sports car, and confused by the mayhem around her, she stumbled forward
between her car and the one ahead with which she had collided.  Zorn,
aware of her perilous position, screamed "No!  Don't stand there!"  She
heard his anguished cry and turned to see who had shouted, but remained
immobile between the two cars.

"Oh, Christ!"  Zorn screamed as a powerful Lincoln town car came up
behind the sports car at almost full speed and slammed into the rear of
the girl's car, shoving it forward so violently that it crushed the
girl's legs between her car and the car in front.

When Zorn reached her she was still pinned between the cars, aware that
she had been hurt but not yet of how badly.  He knew it was essential
that she be dragged from the wreckage so her legs could be attended to
immediately, though he almost feared seeing what the damage was, and he
shouted to bystanders, "Give a hand!"  Two young men, not aware that
they would be in the same danger from the crashing of new arrivals,
sprang to his aid, and by brute strength they moved her car enough so
that she could be extricated.  When she saw that her lower legs,
severed by her own car's steel bumper, were no longer part of her, she
fainted.

Remembering the medical bag he always carried in his sedan, Zorn threw
one of the young men his keys: "I'm a doctor.  Get my kit in the

trunk."  Even before the man was back, Andy had torn strips from
the unconscious girl's dress and shouted: "Somebody give me a branch.

Two branches."  And when these were torn from nearby trees, he twisted
them in the fabric, circling her legs above the knee and providing
pressure to stanch the flow of blood.

When the young woman, still mercifully unconscious, was left in the
care of women from the other wrecks, Zorn went back to the sports car
to recover the two legs because he knew that doctors could perform
miracles in reattaching limbs.  But when he saw that the legs had been
mashed flat he knew the veins and arteries and nerve systems had been
totally destroyed.  There was no possible way of refitting the
fragments, so he abandoned them.

It was twenty minutes before the first helicopter arrived.  It belonged
to a Nashville television studio and could provide no medical
assistance but it signaled for all emergency forces in the area to
report.  After photographing the wreckage for ten minutes it
disappeared, and soon the first medical copter did fly in.  Andy was at
its door before the rotor had stopped revolving: "Medical doctor.  Girl
here with both legs amputated.  She must go first," and when the
paramedics saw her condition, with the improvised tourniquets, they
made space for her and him.

On the brief flight to a waiting Chattanooga hospital the girl revived
and looked pathetically at Andy: "My legs?  Are they gone?"  Andy knew
that in her first moments of consciousness what she needed most from
him was comfort and reassurance.  Taking her hands in his, he said
above the loud humming of the copter: The great news is, you're going
to live.  Friends took care of that."  When terrible fear swept her
face, he released one of his hands and placed it under her chin: "Sure,
there's trouble.  You saw that.  But I promise you you'll have a long
and lovely life."  Aware that she was still trembling, he said: "At
your wedding, I'll ask you for a dance.  Yes, you will be dancing," and
he gently brushed back the hair from her forehead.

This had the effect he wanted, for in a wavering voice she asked:

"Was it totaled?"  and he realized that in her confusion she was
speaking of her car.

"It was, but you were not.  You'll be driving again."  She tried to
acknowledge this vote of confidence but was overwhelmed by a paroxysm
of terrible pain and fainted again.

At the hospital a Dr.  Zembright, an elderly orthopedist who had been
alerted from the helicopter, rushed the girl into an operating room
where he praised Zorn for the precise placement of the two tourniquets:
"You had first-aid training?"

"Medical doctor.  Chicago."

When the unconscious young woman had been attended to, the stumps of
her legs disinfected and antibiotics applied, Dr.  Zembright took Zorn
to a private office where a conversation occurred that the younger
doctor would never forget.

"The steps you took at the scene have probably saved her knees."  The
older man recognized that the still-shaken Zorn needed reassurance.

"She'll thank you a million times in years to come.  Because with knees
in place, it's easier."

"It was hell out there.  I stood eight, ten yards from the highway and
watched helplessly as one damned truck after another piled into that
mess.  Carnage."

"Would a shot of whiskey help?"

"Seldom touch it, but I'd better have one now.  Then I have to look
after my car."

"You left it at the scene?"

"Down a dip to the side.  You'd be surprised how helpful everyone was
pulling people from the fires.  Young fellow who helped me pull the
girl free promised he'd watch my car and trailer.  He wanted me to stay
with her.  He has my keys."

Zembright, knowing from past experiences with shock that Zorn was
teetering on the edge, poured him a stiff shot from his private reserve
and the two men relaxed while buzzers echoed throughout the hospital,
which was becoming packed with the wounded from the pileup.  Andy
tossed his shot at one swallow, then coughed from doing so.

The older man said: "Doctor, I judge from what you told me that you
played the role of a Good Samaritan."

"I did what you'd have done."

"Probably more.  But as a wiser man, I'd have done something else you
didn't do."

"What did I miss?  Will it damage her?"

Zembright leaned back and smiled.

"Her?  No.  You?  Maybe."

"What do you mean?"

"I'm sure I'd also have tried to help if I were driving past, but
because I also know what happens later, as soon as I had helped I'd
have hightailed out of there."

"Why?"

"Because I've learned through sad experience that some months after
you've saved a victim's life through your roadside expertise
administered in time, the son of a bitch is going to hire a sleazy
lawyer and sue you for not having done something else that he thought
might have been better.  And instead of being a Good Samaritan as in
Luke, you find yourself before a judge being condemned for being a
busybody intruder who crippled the very person you were trying to
help."

Zorn, who had ample cause to believe what the Tennessee doctor was
saying, asked: "What would you have done in my case?"

"Just what you did, but then fled.  Given my name to nobody.  Kept my
mouth shut about the entire affair and allowed no one to make me a
hero.  Did you give your name to our people when the paramedics brought
you and the girl here?"

"No."

"I'm going to forget you even gave it to me.  How about the young man
with your car?"

"I certainly didn't give it to him."

"But he could probably find your name among the papers in the car."

"If he snooped."

Dr.  Zembright leaned back, studied his whiskey glass, drained it and
said: "Young fellow, accept a word from an old-timer.  To hell with the
Good Samaritan stuff.  Protect your own ass and hope the patient
lives.

I'm cleared.  If the girl's family tries to sue me, I can claim "Some
horse's ass screwed her legs up at the site."  I'm home free."

Zorn smiled ruefully: "I was in obstetrics.  Two baseless malpractice
suits were brought against me by a lawyer who was splitting jury awards
with the family.  I gave up my practice because I couldn't accept the
lies and perjury and the persecutions.  Now I'm heading for a
nonmedical job in-' "Don't tell me where!"  Zembright interjected
quickly.

"The less I know about you the better.  You never touched the girl. You
never

brought her here.  You never saw me, and I sure as hell never saw
you.

Another shot?"

"One was too many."  As Zorn left the office he said to the doctor:

"Help her.  I was standing as far from her as I am from you now when
she looked down and saw that she'd lost her legs.  Things like that you
remember."

"So long, Good Samaritan."

The older doctor's cynical advice had a powerful effect on Zorn, who
said to himself: If a specialist that old and that skilled can be
worried about how society treats medical men, maybe I was smarter than
I realized in easing myself out of the profession.  But he could not
accept what he felt to be a cheap rationalization for his impetuous
departure from Chicago: "No, for better or for worse I chose a noble
career and at the first signs of trouble I chickened out."

When he returned to the site of the disaster, he stood beside his rig
and pondered whether to continue southward to his new job.  Suddenly he
slapped himself on the forehead: Cut this out, Zorn.  Stop your whining
and your indecision.  I hereby swear that I'm going to make my facility
the biggest moneymaker in the Taggart chain.  And then, someday, maybe
I'll make myself a full-fledged doctor again.

Andy, like most northerners driving south into Florida, believed that
when he left Valdosta, Georgia, he was practically in the heart of
Florida, and that, in his case, Tampa would be only a few miles down
the road.  But when he checked his map he found that he had well over
two hundred miles to go.  Consequently, he drove only till nightfall,
then edged off the road and slept behind his steering wheel, as in the
old days, but the persistent whirring of passing cars made him dream he
was back on that fatal highway west of Chattanooga.  When, in real
time, a brutal semi hauling behind it two immense storage tanks roared
past, he woke with a cry of warning, expecting it to slide sideways
along ice that wasn't there and crash into another truck.  Frightened
by the violence of his reaction he told himself: I'd better get some
hot food in me if I'm to drive all night with visions of disaster
haunting me.  After some pancakes and coffee at an all-night cafe, he
felt better and was soon on the road again.  When he reached the
outskirts of Tampa shortly after eight in the

morning of January 2, he stopped for coffee and received directions
to the Palms: "Keep on Route 41 right through Tampa till you hit open
land followed right after by a wonderful cypress swamp-that is, if you
like swamps.  Cross over a small river and you come to a small town
with a big mall.  Keep watching for street numbers, and when you reach
117th Street, turn sharp right.  Straight ahead's your target, but take
money.  It ain't cheap."

With those helpful instructions he remained on the superhighway to the
city limits of Tampa, where a welcoming sign reminded him of a joke he
had heard in Chicago: "Florida is God's waiting room."  This sign
read:

YOU ARE NOW ENTERING GOD'S PARADISE.  THE O'NEILL

CREMATORIUM.  COMPLETE SERVICES $475.

Slowing down to assure himself that the sign was not a joke, he
provoked loud honking by motorists he was blocking on their way into
the city.  Pulling aside and waving them on with an apologetic smile,
he muttered: "Welcome indeed.  They don't hide their secrets, do they?"
He was then four miles from his future home; the sky was a
scintillating blue; palm trees were blowing in the light breeze; and
the blizzard off Lake Michigan was a thousand miles behind him.
Saluting the attractive offer from the crematorium, he continued on to
his new home.

Soon after crossing a bridge over the little river, Dr.  Zorn spotted
117th Street, and with a sharp turn to the right he was able to follow
the river as it wound its way westward.  But he soon forgot the
attractive waterway, for along the riverbank was a line of immensely
tall palm trees unlike any he had seen before, not even in books.  More
than eighty feet tall, all were completely barren of limbs or even
small branches for two thirds of their height; in that lower reach they
consisted solely of slight, fragile-looking trunks standing severely
erect with not a single deviation left or right.  At the very top of
each tree, and extending for only a few feet downward, was a green
crown of typical palm fronds, but so few that they seemed like
accidental dandruff atop a bald head.  Below the fronds, eighty feet in
the air, they sported a totally bizarre aspect, a thin whorl of jet-black dead
fronds that radiated out from the trunk and parallel to the earth,
giving the appearance of a ruff at the neck of some Elizabethan lady.
Below this dead whorl was the weirdest feature of all, a huge
crisscross tangle of weather-beaten dead fronds, gray-brown in color,
like a half-oval in shape, wide at the top, narrow at the bottom, as if
the tree were wearing an immense bustle built upon brown interwoven
wires.

The damnedest trees I ever saw!  Zorn thought as he stopped his rig to
inspect them.  Look at them!  Naked up to the bellybutton, then that
huge bustle, then the necklace of black pearls, and that preposterous
hairdo on top!  He looked down the roadway and saw that more than a
dozen other towering palms, each a duplication of the first with their
crowns high in the air, marched in order, leading the way to the
retirement complex in which he would be working.

"Well," he said with a shake of his head, 'with that handsome parade
the place is entitled to call itself the Palms."

A flash of red off to the left attracted his eye, and when he turned
away from the palms to inspect it he saw that it was a row of strange
tropical bushes that also lined the road, each about eight to ten feet
tall, extremely wide and covered with copious dark green leaves
decorated with generous clusters of bright red berries.  What handsome
bushes!  Never heard of them either, he thought.

As he approached the end of the roadway he was greeted by an imposing
structure built of reddish stone, a giant gateway consisting of two
turreted towers from which extended a wall made of the same stone.  The
wall was seven feet high and appeared to encircle a substantial area of
manicured lawn, in the center of which stood the single, many cornered
building of the retirement center.  With that gateway and those walls
it's really a medieval fortress, Zorn thought.  A man could find
himself at ease in a retirement place like this.  Then he found that he
had overlooked a significant feature that tied the place to its home
office in Chicago: into the face of the right tower had been inserted a
rather small brass plate containing in cast letters almost as small as
those on the wall outside Mr.  Taggart's office two austere words:

THE

PALMS.

Staring at the modest sign, Zorn said to himself: The chief doesn't go
in for conspicuous display, but then he reflected: Wait!  If you

consider the whole setup-trees, gate, wall-it adds up to one clear
message: class-this place has class.  My job will be to keep it that
way, but to make it profitable.

Once through the gate he entered an oval driveway that curved first to
the right, then under a porte cochere leading to the main entrance,
then on to the left where another porte cochere gave entrance to the
health care area, and around to the exit through the gate.  The area
inside the oval was meticulously landscaped, with a cluster of
varicolored croton bushes near the entrance to the main building.  But
the effect of elegance was somewhat marred by large macadamized parking
lots covering almost every other inch of available space and packed
with cars, many of expensive European make.

As he tried to back his bulky tandem in what he took to be a free area
for visitors, an elderly woman of erect posture and blue-white hair,
neatly coiffed, exploded from the main entrance, waving her cane and
shouting in a voice unexpectedly rough and bold: "Wait!  Wait!

That's my parking space, young man.  Get your contraption out of
there!"

Startled by the fury of her attack, Zorn became confused.  Instead of
maneuvering his car forward and out of the restricted parking area, he
continued backward, which made the infuriated woman think he was
ignoring her protest.  She started beating on his left front fender
with her cane, shouting louder and louder: "Get out of there!  Right
now!

Get your pile of junk out of my parking space!"

Though still disoriented by her attack, Zorn now shifted to go forward
but stepped on the gas so firmly that the tandem leaped forward as if
he were trying to run the woman down.  She screamed:

"He's trying to kill me!"  and stepped back but continued to pound on
the fender.

She was so violent that staff from the main building began running out
to see what trouble she was in this time, for they had learned that the
Duchess, as she was called, lived from one crisis to the next.  Her
room was on the ground floor overlooking the oval, and from it she
could guard the choice parking slot in which she usually kept her
highly polished gray Bentley.  Let a delivery boy try to park there
when her car was in the garage, which it was more than half the time,
and she could be relied upon to rush out, beat on the boy's car with
her cane and force him to move.  She also kept a sharp eye out for
stray

dogs that wandered into what she called My Oval, for she was its
chief protector.

The first official to reach her this time was a chubby, rather nervous
man in his mid-fifties who wore a three-piece business suit and an air
of perpetual harassment.  Running to where the Duchess was still
hammering the fender, he cried in a quavering voice: "Sir!"

"I'm trying to get out," Zorn said plaintively, 'but she won't let
me."

"And who are you?"  the man asked as he tried to pull the woman away.

"Dr.  Zorn.  I'm sure you've been told-' As soon as he heard the name,
the man became obsequious:

"Madam!  Madam!  This is our new director, Dr.  Zorn!"

When the woman heard the word doctor it was as if an enormous lightbulb
had been turned on in her mind.  Her face changed from a scowl to a
smile: "So-you're the new man we heard about.  Time you got here to
bring some order to this dump!"  She glowered again, but this time at
the official who had been trying to placate her.

"I'm Kenneth Krenek, as you may have guessed," the man said, 'and this
fine lady is Mrs.  Francine Dart Elmore of Boston, whom we honor as the
Duchess.  She occupies that bay-window room there and her job is to see
that things move properly in the oval.  She's a wonderful asset to this
place, Doctor, and you'll come to rely on her."

"And don't try any foolishness," the woman said as she turned to head
back to her room, 'because under my pillow I keep a loaded revolver."

"She does," Mr.  Krenek said.

"We've tried to take it away, but she says-' "If a woman lives alone on
the ground floor, available to anyone who comes through that gate, she
deserves a pistol and I have one.  I can use it, too."

When they were alone Krenek told the doctor where he could park his
rig: "You'll learn that your most important job in this place-that is,
the one that gives you the most trouble-is how to find enough parking
spaces for the residents."  With a sweep of his arm he indicated the
cars wedged in everywhere.

"And just as difficult, how to give everyone a spot that's convenient
to one of the doors.  I've tried for eleven years-' Abruptly he
stopped, laughed and indicated the open bay window through which the
Duchess was watching them.  In a voice

loud enough for her to hear he warned: "Remember, if you try to
take her parking space, she'll shoot you with her little gun," and she
shouted back: "I would, too."

When they entered the main portion of the building and were seated in
Krenek's modest office, the temporary manager said frankly: "Dr.

Zorn, I want you to know that I understand you've been sent down here
to run this place, to bring a clearer sense of mission.  I've been the
interim manager, but it was never intended that I remain so.  Mr.

Taggart telephoned this morning and spelled it out.  You're to be
advertised as Dr.  Zorn, but you'll have no real medical duties.  Your
job is to be the director.  I'm a great detail man, Dr.  Zorn, and you
can rely on me to carry out your orders.  But I'm not the man to keep
all the people here happy, and bring in new ones to keep the beds
filled.

That'll be your job."

Tell me what I need to know, Krenek.  The Chicago office spoke well of
you, said you were invaluable, knew which buttons to push."

Krenek blushed: "I hope they know what they're talking about.

We've really needed you, Dr.  Zorn."  Then he said, deferentially,
"Would you like a tour as we talk?"

"Great.  Let's go."

Because Krenek had worked at the Palms since the blueprint stage, he
proved to be a knowing guide: "In this main section called Gateways we
have seven floors, offices occupying most of the first one, with double
elevators at each end.  Twenty-one spacious apartments to each of the
upper floors, that's a hundred and twenty-six apartments plus eleven
single rooms tucked away on the ground floor.  If we had two occupants
in each apartment, we'd have a total of two hundred and fifty-two plus
the eleven singles, but actually we have only about half that
number."

"Business that bad?"

"No!  Not at all!  We're doing about what we expected."  Zorn could not
accept this because in Chicago he had seen the red pin; however, he
allowed Krenek to continue: "Remember that about half the apartments
contain only one person, usually a widow.  We also keep three rooms
available for renting to family friends of our residents who come
visiting.  We could accept maybe four more entrants, but that's about
it."  Zorn wondered where the deficiencies were.

When they reached the end of the long, handsomely decorated

ground-floor hall, Krenek suggested that they ride up to the
seventh floor, and from that height at the far end of the building, he
pointed out the feature that made the Palms distinctive among the many
retirement homes in southwestern Florida: "If you look down there,
you'll see that here our land juts out into the river forming a rather
fine peninsula.  We've built right to the water's edge on all sides,
which means that on each floor we have three suites in what we call the
Peninsula, water visible from all windows."  Eager to demonstrate the
elegance of these apartments, he went to a hall phone and dialed the
number of the middle suite of floor seven: "Chris, this is Krenek.
Excuse me for intruding, but I have with me Dr.  Zorn, our new man from
Chicago.  Yes.  Just arrived, and I wanted to show him an apartment.
Would like to start with our best.  Could I bring him in?  If Esther
will allow it?"

When the answer was a hearty "Sure!"  Krenek led the way to the middle
door of the graceful circle at the end of the peninsula.  The door
opened, with the inhabitants greeting him warmly.  Andy soon realized
that Ken Krenek was a lot shrewder than one might have guessed, for he
had arranged that the first residents of the Palms his new director met
would be one of the most remarkably lively pairs in the center.  Mr.

Mallory, eighty-nine years old, was a Midwestern banker who had amassed
a minor fortune through prudent financial dealings, but he was at the
same time a bon vivant who loved to entertain and frequent public dance
halls, where he and his petite wife of eighty-seven not only did most
of the newest dance steps but also charmed the onlookers with their
strenuous exhibitions of the old dances like the Charleston.

They were, Andy would discover, boundless sources of energy, and showed
every sign that they would continue so into their nineties.

Andy, meeting them for the first time, thought: These are the sort of
people I expected-well-bred, well cared for through the years, probably
never had to worry much about money.  But Krenek quickly killed that
misinterpretation: Chris Mallory was a night-school graduate from the
University of Wisconsin who as a young man had progressed in various
businesses until he became president of a major bank with eight or nine
branches.  He now drove a stock two-door Pontiac, but his wife had
insisted strenuously that they could afford a four-door so that when
they invited couples to drive with them the other wife need not mess
her hair climbing into the rear seat.  He had told her some 3 0 what
mendaciously that he believed they could afford it, and she had bought
a Cadillac, but he did not intend trading in his two-door; he liked its
compact convenience.

He had met his wife, Esther, whom everyone at the Palms called Es, when
she was working as a teller at his bank's Sheboygan branch, and after
watching her masterly way with customers, he found numerous excuses for
inspecting the Sheboygan facility.  At the end of one protracted visit
she had said: "Mr.  Mallory, if you intend proposing to me ultimately,
why not do it now and get our family started?"  He replied as if she
had asked for a loan: "I think that might be eminently sensible," but
he did not formally propose until some time later, for he believed that
bankers should never take precipitate action on any proposal.  Many
years later, when he watched the debacle into which Savings and Loan
managers had plunged the country because they acted incautiously, he
growled: "They should be horsewhipped."

Both the Mallorys acknowledged that his subsequent success in putting
together a banking empire was attributable in large part to Mrs.
Mallory's instinct for bold business moves.  She loved to gamble on new
ventures with whatever excess funds they had at the close of any
business year.  Her acumen regarding new developments in national
finance plus his country-boy prudence in assessing specific situations
had made them a formidable team whose fortunes grew not spectacularly
but with absolute certainty.  Among the numerous well-to-do couples at
the Palms, they were unquestionably the wealthiest, the best dancers,
the freest with their money and the best hosts.

They had been happily married for sixty-one years, and when they
reached their late seventies Mrs.  Mallory, tired of maintaining a
large house in a harsh climate, said: "Let's get out of these hellish
Wisconsin winters and have some enjoyment in life."  Es Mallory had
launched a search committee of her business friends, who recommended
the west coast of Florida.  When Es and her husband saw the
architectural layout of the Palms, they grabbed the largest apartment
on the topmost floor of the peninsula wing.

From their balcony, to which they led their visitors when the tour of
the rooms was completed, Zorn could see to his right the smaller
waterway called the river, and to his left the area where it widened
and became a spacious body called the channel, which was protected on
the west by a chain of small islands on which handsome, low houses
had

been built.

"When a storm blows in from the Gulf of Mexico," Mr.

Mallory said, 'those islands take a real beating.  Water three feet up
in the houses.  But with us, hiding behind the islands, it's never too
bad."

Mrs.  Mallory, who loved the natural features of their site, pointed
across the river to a tangle of trees growing in the water, scraggly
bushes, vines and muddy flats: That's our cypress swamp, a marvelous
place for birds.  Paths run through it, but so do mosquitoes and
snakes.

Stay clear."

As she spoke, Zorn moved around to the eastern edge of their balcony:
"What's the name of those extraordinary trees I saw coming in?  Can
they be palms, as the sign says?"

"They're palms," Mr.  Mallory said, 'that's for sure, but they are
queer.  What you must do is ask Laura Oliphant, the do-good lady on the
first floor.  She knows everything about nature and loves to share her
knowledge."

So on the walk through the corridors to the Assisted Living and
Extended Care wing of the building, Krenek stopped at another telephone
and asked Ms.  Oliphant if he could bring the new director in to ask
about the curious palms that lined the two walks, and she agreed.

Zorn wondered where the second walk might be.

Before they reached her door, Krenek whispered: "She occupies our most
inexpensive apartment, doesn't have much money, but she's one of the
most valuable residents we have.  People call her "our dogooder,"
because she has a fantastic moral conscience.  Her role in life has
always been to make things better than they are."  He chuckled:

"But she's no dreamer.  She doesn't want to do all the work herself.
She intends from the moment she meets you for you to do the heavy work.
I sometimes tremble when I see her approaching, because it means she
has a new job for me."  Nevertheless, Andy noted, Ken knocked on her
door with real enthusiasm as if assured that his new director was about
to meet a woman of extraordinary qualities.  As they waited for the
door to open, Zorn asked: "Did I hear you pronounce it "Miz Oliphant"?"
and Krenek explained: "She insists.  She's been a leader in the battle
for women's rights."

Ms.  Oliphant welcomed them into what was clearly one of the least
expensive apartments at the rear of the building, but it provided ample
space, made almost ideal by opening onto a small plaza that fronted on
the channel, where privately owned boats of all dimensions

drifted by so close to shore that she sometimes felt she could
reach out and touch them.

"It was made for Laura," Krenek said as the men sat facing her.

"Not long ago she had both hips replaced and she wanted something on
the ground floor so she could walk directly onto the plaza and exercise
her mechanical joints.  You've done wonderfully, haven't you?"

"I'm not penned up, that's for sure."

"What was it?"  Zorn asked.

"Arthritis?"

"Yes.  By the way, have you heard about the Georgia cracker who said:
"My friend Oliver was told that his wife was in bed with Arthuri-tis,
and he swore that if he could find where that guy Arthur lived, he was
gonna shoot him"?  Last year I wanted to shoot him, too, but this hip
operation is sensational.  And I was seventy-five when I had it."

She asked to be excused for a moment while she prepared a welcoming
drink for her guests, and when she got up Andy had an opportunity to
look at her more closely.  She was of medium height, spare in
appearance and very determined in her gestures, as if she did not wish
to waste a minute of her time.  She had fine-looking thick gray hair,
which she wore in a trim schoolboy bob.  Returning from the corner of
the room that served as a kind of kitchenette, she brought with her a
silver tray on which stood three elegant glasses containing a pale
reddish wine.

"It's called blush," she said, as if that were a name equal to port or
sherry.  Krenek explained: "It's good old vin rose from a California
winery, but our women residents like to call it blush, as if that
dignifies it in some way."  She shot back with "You keep your mouth
shut, Kenneth, or no blush for you."

Krenek took a substantial gulp of the wine, declared it to be superb
and said: "Dr.  Zorn asked the Mallorys the name of our famous palm
trees, but none of us could remember because we're not really tree
people."

Ms.  Oliphant took a guide from her shelf, thumbed through it till she
reached the palm section and read: "Florida can boast of eleven native
species of palm trees, including all the most famous ones except the
spectacular traveler's palm of Africa, with its fanlike branches in a
flat display."  Looking at Zorn, she said: "So our remarkable specimens
could be almost anything in the book, but actually they're

unique," and she showed him an exact drawing of the trees he had
stopped to inspect: "I'm sure you've spotted the salient features."  He
noticed that she spoke eagerly, with a professional interest in
enlightening others: "It's the Washingtonia, that's its proper name,
but no one can tell me how it got the name.  It's a wonderful tree, but
it's not native to Florida!"

Ms.  Oliphant rose, walked vigorously to her door and led the way to
her private plaza without using a cane, and he asked admiringly:

"How long ago was your operation?"  When she replied: Three months," he
said: "Miraculous.  I know strong men who're afraid to walk without a
cane after six months," and she said: "I couldn't wait."

She was the first person he had met at the Palms who could properly be
called a patient, and to see her striding about with such spirit was a
reassuring sign.

When they were out on the plaza she pointed south and there, along the
channel with its little boats, was the second row of the amazing palms
like a file of drum majors on stilts.  But much as he admired them he
could not understand why the trees had that curious ruff of black.

"Simple, really," she said.

"You can see that the fronds on top are green, the ones in the snarl
below are dusty brown.  A year ago the black ones in the middle were
alive and green.  Like all else in nature, at their appointed time they
died and turned black.  But they still retained strength enough to
reach straight out in a whorl.  As sap leaves them and they really die,
they'll turn brown, lose their strength and form part of the tangle
below."

Zorn was impressed that she was so knowledgeable: "You amaze me with
your ability to make things clear.  I've had college professors-' "I
was headmistress of an elite private girls' school.  With a group like
that you'd better be able to explain things."  She paused, then
laughed:

"Young girls can be so much more inquisitive than young boys their same
age."

"I'm fascinated by that inverted teardrop effect," Zorn said.

"Does the tangle remain forever?"

"In due course the whole tree dies.  Its roots cannot sustain it.  Some
night in a storm it topples and the solemn grandeur is gone.  Even the
dead fronds die again."  She did not deliver this judgment funereally,
for as she spoke she turned to point to the edge of what appeared to be
a

low jungle and there a Washingtonia not three feet high was
starting its climb toward the stars.

"Eighty more feet to go," she said brightly, 'but it'll make it long
years from now."  She paused, studied the ambitious little tree and
said: "Of course, none of us in residence now will be around to applaud
its victory."

Dr.  Zorn was eager to see the hospital, but when he used that word,
Krenek corrected him: "We never say that.  Remember, with most Taggart
operations it's a twofold deal, Assisted Living and Extended Care. Both
part of the same structure."  And he led the way out of the main wing
and into the oval so that Zorn could approach the other wing as if he
were a visitor coming to inspect facilities.  There embedded in the
wall beside the entrance was the sign in small letters ASSISTED LIVING,
and inside was a handsome reception area designed to make visitors feel
they had entered a place truly dedicated to their welfare.  The
receptionist wore a nurse's uniform.  Medical journals were stacked on
tables, and carefully placed signs indicated doctors' offices,
rehabilitation clinics and the dietitian's room.  Certain business
offices for the entire establishment were also here, dealing with
health services and limousine reservations for residents who wanted to
shop in the nearby mall or visit medical men outside the Palms.

As Ken invited Zorn to join him for coffee in one of the offices, he
explained a major peculiarity of the place: "Under Florida law, which
the medical profession has enacted to protect itself, no one on our
premises, not even you as medical adviser, is allowed to prescribe or
issue so much as an aspirin, or tape a broken finger, and certainly not
treat a serious illness."

"What must I do?"

"You must advise the patient to get in touch with his or her own
doctor.  A score of them practice nearby.  That doctor must do the
diagnosis and establish the treatment.  That doctor alone can recommend
that a patient be moved into our Assisted Living facilities or go into
one of the local hospitals."

"I thought the idea was that anyone in the main building who became
ill could be transferred automatically to this building."

"Only under doctor's orders-an outside doctor."

Zorn considered this for some moments, then said: "So our advertising
stressing complete health care-' "Is false."

Again Zorn fell into silent thought: "Ironclad rules?"

"Yes.  To protect the local medical men."  Having said this, Krenek
quickly added: "And also to protect us from lawsuits if our personnel
were to give improper diagnosis or medication.  The law safeguards us
as much as it aids the local doctors."

"Why don't we make that clear in our advertising?"

"Because people coming in like to feel they're safe for the remainder
of their lives.  They are, of course, but under a rather different set
of rules from what they imagined."

"But isn't that a fraud?"

"An amiable one-does no harm to anyone."

"Except in the pocketbook."

"Nothing in this life that's worth a damn is inexpensive.  Especially
the American health system."  Before Andy could break in, Krenek added:
"Living in the Palms is not cheap, Doctor.  Our residents can afford
medical care, and we assure them the best."

"On our terms?"

The state's.  Health services for older people are big business in
Florida, and everyone is careful to protect his share of the economic
pie."

When Krenek was called away to handle a phone call, Andy contemplated
his surprising situation: "Here I sit, a certified doctor with these
handsome facilities at hand, and I'm forbidden to use either my own
skills or these wonderful lifesaving machines.  I've thrown myself into
a weird world."

But when Ken returned to resume their trip through the Assisted Living
facilities, Andy noted with growing approval the neatness of the place,
the attractiveness of the individual rooms, the warmth of the public
areas and the exceptional congeniality of the small, well decorated
dining room.  It was, he judged, a part of the larger building in which
one could reside in comfort and care as one recovered from

an operation or a broken limb.

"It's not a permanent residence, you understand," Krenek said.

"In and out's the motto here, with an emphasis on rehabilitation.  But
we spend great effort to make patients comfortable and happy while
they're on the mend."

The conviction in these words was somewhat dampened when one of the
doors leading to a private room on the second floor was banged open by
a handsome woman in her seventies who rushed out into the hall.

Her slim, well-groomed appearance bespoke years of careful attention to
good health habits and the free expenditure of money for clothes.  But
dominating all else was a face of exquisite porcelain beauty, with the
classic lines of some Greek sculpture and framed by silvery hair.

Slightly taller than the average woman but much slimmer, she looked as
if she should always be dressed in flowing garments of a romantic past
and sitting beside a glowing fireplace in the great hall of some castle
as evening shadows settled.  She looked to be the kind of woman Zorn
had not often encountered while performing his medical duties in
Chicago.

Incongruously, this delicate beauty began to assault Krenek with the
utmost fury.  In the shrill voice of a streetcorner harridan she
accused him of snooping on her, of incessantly abusing her, and of
trying in every devious way to steal her money.  These were devastating
charges to lodge against a man whose job it was to make life easy and
safe for her, and Zorn was amazed that such charges had been allowed to
accumulate without attracting the attention of someone with enough
authority to correct them.  Before he could intervene to ask the
distraught woman for details, especially about the theft of the money,
he was surprised to see Krenek face his accuser calmly and say in a
quiet voice: "I know, Mrs.  Duggan, these things must distress you, but
I'm having a meeting this afternoon with Scotland Yard, and they've
promised to look into this sorry affair.  Now, if you'll wait in your
room till after lunch-' Thank you, Dr.  Penobscott.  I can always rely
on you for help."

Then suddenly she turned to Zorn: "But you, damn you, you'll be hanged
when your behavior is exposed," and she was so wild-eyed with fury that
Andy fell back lest she attack him with her long, pale pink
fingernails.

She fell silent, not because of anything that Krenek did but because of
something she saw over Zorn's shoulder.  From the elevator that

brought visitors to Assisted Living came a man in his mid-seventies
who looked out of place in the posh surroundings; his misshapen nose,
broken often by fists, gave him the appearance of a stumble bum
pugilist who moved about alleys and barrooms shadowboxing with
imaginary foes. Shorter than the elegant woman he approached, he had
thin, wispy hair and watery eyes but an aggressive manner.  Elbowing
his way past Zorn and nodding to Krenek, he moved directly to the
woman, took her hand and said in a voice as soft and gentle as his
whiskey roughened throat would allow: "It's all right, darling.  I've
come to take you to lunch."

With a grace acquired from attending the grand balls of New York
society, she accepted his arm, smiled at the two men she had been
abusing, and allowed the tough-mannered little man to lead her toward
the open elevator doors, but as she neared the entrance she stopped,
whirled around and screamed at the man: "Damn you!  You stole all my
money.  And when Scotland Yard gets here, you're going to hang."  She
pushed him aside and entered the elevator, still heaping abuse on the
man beside her.

When the couple were gone, Krenek said quietly: That's Marjorie Duggan.
As Marjorie Bates Lambert she reigned as a queen of Manhattan society.
Her husband owned four major department stores along the East Coast.
After he died people have told me all New York was amazed when she
married Muley Duggan, the man you just saw.  He'd been head of a
trucking company Mr.  Lambert had used to service his stores.  She must
have appreciated Muley's rough-and tumble ways after the stiff
high-society propriety of Mr.  Lambert and his side of the family.
Anyway, she married Muley and I believe they were very happy, with lots
of money and a lively way of spending it."

"And then?"

"Alzheimer's."

"You must see a lot of that in a place like this.  In my practice I saw
none."

"Constantly.  And sometimes it almost breaks your heart.  People that
you know were wonderful.  Lively, bright, concerned, totally in charge
of their lives.  And suddenly the lights dim.  They flicker.  They go
out.  The brain almost vanishes, but the body goes on, sometimes
seeming even better than before because it's no longer under any
tension."

"That must produce bizarre conditions."

"It does.  When we receive an Alzheimer's case off the street,
never been with us in the other building, we often think: "This poor
woman ought to go straight to the third floor.  She can't survive very
long."  But she comes to this floor, good care, good food, pleasant
surroundings, and she appears to flourish for a while.  As her mind
disappears her body remains relatively strong, and we realize that she
could be here for years, mind fading constantly, body failing more
slowly but death refusing to knock on her door."

"More women than men?"

"Fifty-fifty."

Krenek said that the Palms had three families with Alzheimer's in which
the victim lived in Assisted Living while the healthy spouse continued
in Gateways.

"Two of the cases, it's the wife who's over here."

"How does it end?"

"It's not uncommon for the healthy partner to die first, worn out by
the strain of incessant caring for the stricken partner.  It's as if
the sane person surrenders: I cannot bear this terrible burden any
longer.  Life on these terms has no meaning."

"What happens to the Alzheimer's patient?"

"At our level, I mean our economic one, the sane spouse has usually
made full arrangements for extended care for his or her partner.  So
the loved one who has died without dying lives on and on, knowing
nothing, not even aware that her husband is gone.  Then one day, far
down the road, she quietly dies, having known nothing for many years."
He paused, looked out the window, and said: "When you work with
Alzheimer families you learn what love is, what terror can be, and what
nothingness in life in certain forms can mean."

The people involved must from time to time think of euthanasia."

"Not in this establishment.  It's a forbidden word."  His voice became
stern: "You must understand, Doctor, that the Alzheimer folks are still
alive.  There's no reason why their life should be terminated simply
because they no longer have a functioning brain.  Do you exterminate a
diabetic because he's lost a leg?  Or even two legs?"

At the mention of lost legs, Zorn suddenly felt faint, overwhelmed by
the memory of a bloody scene and of himself kneeling down to recover
the legs of the stricken girl who would never use those legs

again.  Hastily putting out his hand to steady himself, he looked
out the window as Krenek asked: "Are you all right, Doctor?"

"Yes.... I was wondering what you call those red bushes we saw as we
came along the drive.  The ones down there."

"I've been told half a dozen times, but I forget-we should have asked
Ms.  Oliphant.  I'm going to call her now and write down what she tells
me.  Visitors often ask."  He placed the call from a phone near the
entrance to the dining room: "Laura, I should have asked when we were
with you.  What's the name again of that red-budded bush along our
entrance?  Yes, I knew it was Brazilian something.  Brazilian pepper
tree, and you say it's a pest?  Outlawed by the state?  You cannot
plant it in your garden or any public place.  On our land it looks
great."

When he hung up he said: "Well, you heard.  It's the Brazilian pepper
tree," but Zorn had not heard, nor did he hear now.  Painfully, he was
remembering a beautiful girl in her early twenties who had fainted in
his arms, and he felt a tremendous desire to fly back to Chattanooga to
see how she was progressing.  Thinking of Dr.  Zembright's wise counsel
about staying clear lest lawsuits be initiated, he banished the
fleeting thought, but he did offer a fervent prayer: "God, give her the
courage to battle it through," and he wondered if she'd be able to use
the amazingly effective modern prosthetics.

As they left Assisted Living to walk up to the top floor, Krenek
said:

"New staff frequently make the joke: "Second floor's Assisted Living,
third floor's Assisted Dying," but we forbid such levity.  We don't
allow the word hospice, either."

"Yes," Zorn replied.

"I know it's called Extended Care.  But extended to the point of
death?"

"Yes."  As they came into the sunny and immaculate hall with its
colorful wallpaper, comfortable chairs, and little enclaves by picture
windows, Krenek said: "Americans are uneasy about dying.  The entire
nation all the way to the Supreme Court is scared to death about the
simple act of dying.  We can't define it.  We can't provide for it.  We
can give family members no guidance as to how to respond to it.  Up
here we mask it with the euphemism Extended Care as if it were hanging
on to life that mattered, not the orderly passage on to death."

"You cover a long span of human experience here in the Palms, don't

you?  Full mental capacity in a person's sixties to little or none
in his or her nineties?"

"It does seem to work out that way, but some of our ninety-year-olds
are still in full control."  He led the way to a broad window from
which in their last days the patients could see a handsome spread of
nature: The row of palm trees that impressed you so much, the channel
with the lively boats passing back and forth and that magnificent
stretch of savanna.  You could be at an oasis in Africa."

"Savanna?"

"Yes.  I believe that's the scientific name for extended grassland that
contains a scattering of low trees.  Anyway, that's what somebody
called it before we got here, and we like it."

"Am I free to walk through it?"

"Oh yes!  It's one of the features our residents appreciate most.

There's a footpath beside the channel.  It's marked by the palm trees,
and you can walk for maybe a mile.  Some do."

"Do we own it?"

"A decent portion, but most is owned by a church.  It's not worth much
as land, farming and the like, but it does face the water, so it's
really invaluable.  Our adventurous residents consider it one of the
most valuable features of the Palms."

"Could you show me how to reach the footpath?"

"Walk to the far end of the main building, go out the door and turn
left.  You'll enjoy it."

When Zorn left Gateways and headed south toward the savanna, he saw
instantly what a remarkable place the Palms was, for to his left that
is, to the east-lay the swimming pool while to the west stood that row
of glorious palms, eighty and ninety feet high.  In the open space
between the trunks he had a fine view of the channel and its rich bird
life.  He could see pelicans dive for fish or long-legged birds he
could not name, some black, some white, that seemed also to be fishing
but in their own motionless way, waiting for the fish to come to
them.

Nature surrounded him and he felt at ease.

He had proceeded about two hundred yards from the Palms when he came
upon an elderly black man perched on a four-legged stool and
maneuvering a long fishing pole whose baited hook he kept far out in
the water.

"Any luck?"  Andy asked, and the man turned on his stool.

"About like always.  I usually get one or two small ones."

"What do you do with them.  Fry them?"

"Oh no!  I live at the Palms back there.  Their cooks wouldn't know
what to do with fish that wasn't frozen.  All meat and potatoes is
their specialty."

"I'm going to be at the Palms too.  New member of the staff.  Name's
Andy Zorn."

The fisherman propped his rod with the aid of two big stones, rose and
extended his hand: "I'm Lincoln Noble, federal judge from the St.

Louis district, retired of course."

As he spoke, four of the long-legged birds Andy had passed flew boldly
in to cluster about the old gentleman.  They had learned he was their
friend and that when he ended his day of fishing he would throw his
catch, one by one, to them.  He was their supply ship along the channel
and they now jockeyed for favorable positions, two very tall blackish
birds and two reasonably tall slender birds with snow-white feathers.

"Those are my herons," he said of the first pair.

"Victor and Victoria.  And the white ones, the egrets, I call my
princesses.  Are they not exquisite?"  When Zorn studied the birds more
closely he noted their incredibly thin legs, long as reeds in a windy
marsh, their lovely feathers and their graceful necks that seemed three
feet long and realized that he had not fully appreciated their beauty
when he first saw them.

The four birds had learned from generations of experience how to
maintain a safe distance from any other living thing, a separation that
would permit them to take instant flight if menaced, and they observed
the rule until the moment they saw Judge Noble unfasten his reel to
reach for the day's catch.  Then, abandoning caution, they crowded in
till he could almost touch them, and as he threw his fish one by one
onto the ground nearby, they thrust forth their long necks and
amazingly long bills to snap up the morsels.

"Oh!"  the judge cried as the birds came closer.

"Are they not a delectable foursome?"  But Zorn did not answer, for one
of the white egrets in search of a fish had come almost to his shoe
tips and for a moment, until the delicacy had been safely taken, the
egret looked up into the doctor's eyes and seemed to smile in
companionship as he prepared to gulp the fish.

"What were the names again?"  Zorn asked, and the judge repeated:

"Blue heron, white egret."

"Which are your special friends?"

"Whichever comes closest on that day.  But don't I have a wonderful
richness from which to choose?"  Before Zorn could reply, the judge,
who was facing the channel, cried: "Here he comes!  The best of all."

And onto the water at the fisherman's feet crash-landed a huge bird
built like a truck in comparison to the egrets, who had the sleekness
of racing cars.  It was a pelican, ungainly, almost ferociously ugly,
all out of proportion with an enormous feathered bottom and a gigantic
beak hinged so far back into its head that when opened it looked as if
he could admit a small motorcycle.

"His name is Rowdy," the judge said, 'and if I hadn't saved him a fish,
he'd have cursed me roundly."  Even though it looked as if the pelican
was assured of at least one fish, he made rude grunting sounds as he
approached his friend.  He was almost a caricature of a bird, and as
Zorn watched him waddle about like some pompous official monitoring a
parade, he intuitively liked him.  The pelican opened his cavernous
mouth into which the judge popped his last catch of the day, and after
performing a postprandial dance, Rowdy rose a few feet in the air and
glided back to the channel, where he landed with a splash that might
have been made by a hippopotamus who had fallen into the water.

Judge Noble, his day's work done, folded his chair under one arm,
propped his fishing rod over the other shoulder, bade Dr.  Zorn
goodbye, and marched back to his quarters in the Palms, leaving Andy
free to continue his exploration of the savanna.  Some distance beyond
the fishing scene, he came upon a slight opening through the matted
grass, low shrubs and intertwined tree limbs, and recklessly he plunged
into the heart of the wilderness.

Surrounded by luxuriant gray-green shrubbery and tough grass with here
and there a low tree, he had one of the strangest sensations of his
life.  Suddenly he was a boy again in a suburb of Denver and his father
had come home with exciting news: "Andy, that movie house off Larimer
Street is showing a wonderful old film, especially for children, and
you must come with me.  I saw it years ago and it has more wild animals
in it than any other film ever made."  When Andy wanted to know what
the movie was called, for he was suspicious of his father's
recommendations-usually the films were too complex for him to
understand-his father replied: "Trader Horn.  It's about an adventure

in Africa, with lots of lions, crocodiles, giraffes, zebras.  I saw
it years ago and never forgot."  Now, years later, Andy could still see
the poster he had studied while his father bought the tickets.  It was
a gorgeous affair, big and in bright color showing an African woodland
scene full of exotic wild animals: TRADER HORN, THE EPIC OF THE WILD.
And he could still see those thrilling names of the leading actors
Harry Carey and Edwina Booth.  On the poster she wore very little, was
menaced by lions and was unbelievably beautiful.

He could not remember much about the movie-there was the bounteous
supply of animals, as promised-but Edwina Booth still echoed in his
memory.  She had been an effective heroine, but what had captured his
imagination was what happened after the film had been shot.  News
reports said that during her heroic work in Africa she had either
suffered a terrible case of sunstroke or contracted some debilitating
disease, which would prevent her from ever making another film, and she
never did.  For years thereafter he would catch himself brooding about
Edwina Booth: "Why couldn't some doctor have saved her?  Why didn't
they get her to a proper hospital where the nurses-' Often he
speculated about how he would have handled her case and could see
himself dressed in white as he gave a series of orders to his admiring
assistants and nurses.  It was not preposterous to claim that he had
become a doctor in order to be on hand to save the life of some future
Edwina Booth were she to be brought into the hospital where he
worked.

So now, on this fading afternoon as he explored, he was examining not
an untamed corner of western Florida but the jungles of Africa, on the
trail of lions, and behind that clump of bushes he might very well come
upon Harry Carey and Edwina Booth and be of service to them.

On and on he went, past the baby Washingtonia palms, past the scattered
Brazilian pepper trees with their bright berries, and into a land as
rough as if it were indeed in the heart of Africa.  And he was
mesmerized.

The sun had sunk low in the January sky when he came upon an enchanting
sight: a small oval pond-filled with water of a character he had never
before seen or heard of.  It was green, but not a stagnant or
weed-covered green.  It was bright emerald, the most beautiful green he
had ever seen, scintillating, resplendent, a green that one might see
in a magical dream.  When he bent down to inspect it more closely he

saw it was composed of a million tiny specks of something-buds
perhaps, tips of submarine plants, but whatever they were, in the mass
they presented a magnificent sight.

He was unaware, as he knelt beside the emerald pool, that he was not
alone.  Off some yards to the west, toward the channel and deep within
the low bushes, lay a huge rattlesnake some eight or nine feet long and
as thick through the middle as a big softball that children play with
before they can manage a real baseball.  The snake had lived close to
his assured supply of water and careless mice and squirrels for more
than a score of years, during which he had occasionally watched some
huge and unfamiliar animal like Dr.  Zorn come to the pool.  Since he
had never attacked them, they could not have been aware of his
presence, but whenever they did move near, he coiled in preparation to
activate the hornlike buttons on his tail, sending a warning that he
was prepared to defend himself.  Fortunately for the explorers, this
had never been necessary.

One morning many years ago, when dew was on the foliage near the pool,
a young woman in shorts and heavy boots had lost her way in the savanna
and had beaten her way noisily through the brush trying to find some
path that would lead her back to the waterway and its footpath that
would lead her to safety.  The Palms did not exist then, so she could
not use it as a guide, but she did have a useful sense of direction
that told her roughly where west and the channel would be.

So after pausing to admire the extraordinary green pool, she continued
westward, her heavy boots taking her within a few feet of the coiled
rattlesnake.  Had she taken one more step in that direction the snake,
with its enormous charge of deadly poison due to its exceptional size,
would surely have struck at her exposed white leg and she would have
died before she could even signal for help.  Fortunately her foot fell
short of the fatal mark; however, she had moved so close that the snake
had to sound a warning.  He did not want to attack this strange
creature so much bigger than his usual targets, but he was prepared to
do so if it came closer.  Accordingly its rattling was so loud and
insistent that the girl froze, not knowing what the sound was nor where
it came from, but aware that it was a warning of some grave danger.

Searching for an explanation, she looked down and saw the monstrous
snake, perfectly coiled, its tail vibrating furiously.  The snake saw
her, and for an agonizing moment each stared into the eyes of the

other.  Then quietly she withdrew her trespassing foot, which
encouraged the snake to cease his signaling.  Slowly, her heart beating
furiously, she moved away from both the pool and the snake.

When she rejoined her companions she told them breathlessly: "Oh, what
a terror!  I looked down among the low bushes and there it was, the
biggest rattlesnake anyone ever saw," and she formed her two thumbs and
forefingers into a circle five inches in diameter, the exact girth of
the snake she had just seen.  The young men in her group derided this
claim: "No snake but a python is ever that big around," and her
listeners concluded that she had probably seen a harmless garter snake
and been terrorized.  She did not argue back; a girl knew she gained no
advantage by contradicting young men who were sure they knew more than
she.  But she had seen the snake; in that terrible protracted moment
when she and it stared at each other, she'd had ample time to form an
estimate of its size, and she knew it was still there beside the
emerald pool.

When Dr.  Zorn made his retreat from the pool he had a good guess as to
where the channel lay, and his path carried him well away from the
rattler's hideout.  The snake made no noise, nor did the doctor through
clumsiness disturb the peace.  Safely he passed on, worked his way
through the savanna that had destroyed Edwina Booth, and came at last
to the footpath leading back to the Palms.  Retracing his steps when
entering the area, he reached his new quarters and was eager to report
to Krenek: "I'm going to like it here.  Interesting residents.

Responsible health care.  Clean buildings, and a fascinating bit of
unspoiled savanna right outside the door.  Three wonderful birds
welcomed me-herons, egrets and a half-drunk pelican."  Unpacking his
trailer, he quickly organized his few possessions in the furnished
apartment assigned to him, eager to begin confronting the challenges of
the Palms.

On his first full day at the Palms, the new director appeared early in
his new office and approved its spaciousness and feeling of
centrality.

He found Kenneth Krenek, nineteen years older than himself, waiting

for orders on how the center should be run, but Zorn was not the
type of man to be dictatorial: "Let's make it Ken and Andy, and I need
to know most of what you know."

"All right.  In our two offices it'll be Andy and Ken, but before the
staff and certainly when visitors come to inspect, it's got to be Dr.

Zorn.  Impresses the public."

Without being asked, he drew up a chair and said: "Andy, the Palms has
enjoyed a pretty good reputation thus far, so we must do everything
reasonable to enhance it.  This is a first-class operation, not top
dollar-there are others more expensive-but top service and we've got to
keep it that way."

"That's what I promised Mr.  Taggart, but I'll need your counsel if I
begin to make mistakes."

"You understand the basic principle of a place like this?  Lure them
with a fine residence hall, good service, good food and good
lifestyle.

That's Gateways here.  Then bring in recuperation cases from the local
hospitals for Assisted Living.  Be very, very nice to the hospitals.

Anything they want they get, because their referrals pay our bills.

And finally there's the third floor, Extended Care, where they come in
the last stages, more than half from outside as their last resort."

"Is it my responsibility to keep those two parts filled with
patients?"

"We all have to work on it.  Miss Foxworth will keep you posted on
occupancy and the profit-and-loss situation.  She's our accountant and
a wizard with figures.  Trust her, and rely on her to keep you on
course."

Andy nodded.

"You know, much of our good name comes from what residents of Gateways
say about us.  So you've got to keep them happy.  There's still one
special problem, you'd never guess.  Names!  Each apartment, it seems
to me, has its own preferences as to how the incumbents prefer to be
called.  With St.  Pres it's Mr.  Ambassador.  I think he'd scowl if
you dared call him Richard.  And Jimenez, our grandee from South
America, would actually faint if you called him Raul.  Muley Duggan is
Muley to everyone, of course, and Mrs.  Elmore actually prefers
Duchess.  President Armitage is usually given that title though he
stopped being one years back.  Everyone calls our black jurist Judge
Noble and he prefers them to do so.  But the Mallorys, Chris and
Esther, prefer first names, even though they're both millionaires.

"We do not pry into the financial conditions of our residents, and

when I show you the list of people for whom Miss Foxworth has
quietly made reductions in their fees because investments went sour or
dividends dropped, you'll be surprised.  Mr.  Taggart's always been
generous in that regard.  He preaches to us: "If we get ten years of
high rent from a husband and wife, when she becomes a widow or her
fortunes fail, we can afford to carry her at a lower rate for the last
years of her life, but we don't want her to linger on into her late
nineties."  ' As he said this he started to chuckle: "I think we'd
better bring Miss Foxworth in right now to explain the financial morass
in which we operate.  All legal, all fair to the residents.  But also
insanely complicated."

During the break that followed he explained: "Miss Foxworth and I have
been working here for eleven years.  We supervised the construction for
Mr.  Taggart, and it's our passion to see this place succeed.  We'll
help you in everything you do."

When Miss Foxworth appeared, Andy saw a thin, angular woman in her
early fifties with a pulled-back hairdo that made her seem austere but
an impish smile that enabled her to laugh at the contradictions with
which she worked.  Thrusting out her right hand she gripped his firmly:
"Welcome to one of the best.  It's our job to keep it that way, or even
improve our standing.  Don't hesitate to experiment, and I'll support
you financially every time I can."  Then she growled and said in a
husky voice: "But we won't kid ourselves.  The Big Bad Wolf in Chicago,
he'll be inspecting the bottom line very carefully.  And so will I. And
so will you, Doctor, if you're as smart as they say."

At Krenek's suggestion she explained various aspects of a Florida
retirement center: "On Gateways we break even, but profit from splendid
visibility.  On Assisted Living we lose money, not excessive but enough
to be irritating.  And on Extended Care we can earn a bundle if we keep
the rooms filled.  What we hope from you is to improve each of these
balance sheets.  And we think it can be done."  She stared at him
intently, then said: "Your predecessor was a grand guy, everybody's
friend except mine, because I could see he was running this place into
bankruptcy.  I'm sure you're not going to be that stupid."

She then explained the pricing policy for Gateways: "We're like every
other retirement area in the country.  We hand-tailor our pricing
structure to fit the needs of the individual couple.  First option is
the one that made the first retirement areas famous.  Up front you give
us all your

assets plus your retirement income, including pensions, and we
undertake to care for you for life, at the end of which your estate
gets nothing back.

An enticing deal in the early years, until places like this found that
with good health care, a dietitian's dinner each night and no worries,
people lived longer than expected and the centers started going broke.
Old people found themselves out on the street.  I was employed by one
of those places and it was a tragedy.  So now we offer three standard
deals.  In each of them you start by paying two hundred fifty thousand
dollars up front for the deluxe suites, less for the one roomers  Then
you pay a substantial monthly sum-say, eighteen hundred dollars every
month-till you pass away, when we give back to your estate eighty
percent of your original investment.  Great for residents with children
and grandchildren.  Plan two, same initial payment, but a smaller
monthly rental and fifty percent return at your passing.  Fair all
around.  Third plan, same quarter of a million deposit, a much lower
monthly rate and twenty-five percent back at the end."

"Which is best for us, best for the client?"

"We never use that word "client."  Too legal.  Doctor, I assure you
they all work out to be dead equal.  We're like the insurance
company.

Unless we conform to the statistics of the American Actuarial Tables,
which report the longevity of American men and women, we go broke.

How old are you?  Thirty-five?  You have a predicted longevity of 39.7
more years, so if you entered the Palms today as a paying resident,
which we wouldn't allow because you're much too young, we could arrange
a very attractive deal for you, because you're going to be paying us
for each of those thirty-nine years."

She looked at Zorn as if weighing whether he was bright enough to
understand, then laughed: "In the old days when it was "Give us
everything and we'll take care of you for life," there used to be a
saying: "What we're looking for is old folks who enter when they're in
their healthy sixties, so their medical bills won't be high, then have
the decency to leave us when they're eighty-two so we can sell their
room again."  ' "What would you say was the optimum now?"  Zorn asked,
and she had an immediate reply: "I like to see them come in at age
sixty-five so they can enjoy the place and say their farewells at about
eighty-eight before they begin to accumulate huge medical bills."

"Sixty-five seems awfully young," Zorn said, but she countered: "Ask
our people.  Many of them tell me: "Roberta, my husband and I
should have come here ten years earlier.  The only sensible thing to
do."  She laughed, her bright eyes showing that she was giving only a
partial report: "Of course, I'm forgetting couples who try us out for a
month or two and then flee, with either the husband or the wife vowing:
"I'll never again move into one of those jails!"

"But seriously, Doctor," she concluded, "I can think of a dozen or more
couples who were originally savagely divided on the issues but who now
confess that it was the best thing they ever did."

As she was about to leave the office with her formidable armful of
papers summarizing the finances of the Palms, Zorn interrupted:

"Please stay with me a few minutes longer, Miss Foxworth.  And Ken,
would you mind giving us a moment alone?"  When Ken had stepped
outside, Andy smiled and asked: "Suppose you, with all your figures and
knowledge, were in my position with no dumb men telling you what to do?
What moves would you make to turn this place around, red deficit into
black profits?"

Pleased to have at last been consulted as an equal, she looked down at
her hands, leaned back and reflected, then said: "I'd do everything
possible to fill the Gateway apartments, but that's not your real
problem.

You've got to get more beds filled in Assisted Living.  That's where
the profits are hiding.  Extended fills itself."

"So how do I get the extras for Assisted?"

"I really don't know.  Advertising won't do it.  We've tried that.  But
I do know this.  Favorable comment, of any kind, makes an immense
difference.  So you've got to get this place talked about.  You've got
to do things that attract attention."

"Like what?"

That's your problem."  She smiled: "That's why Mr.  Taggart gave you
that sixty-five-thousand-dollar salary."  She smiled a second time when
his jaw dropped: "And hopefully, from what Chicago tells us, you're the
man to swing it, Dr.  Zorn."

When Krenek returned to the office after her departure, he deemed it
appropriate to let Zorn know that he, Ken, appreciated the
accountant:

"She's a wizard with figures.  Made a study of our hundred and eighty
six residents one year and calculated how many deaths would occur
statistically in each month of the next three years.  She kept careful
records and told me in October of that year that she was right

on target, but November proved an unusually healthy month and at
Thanksgiving her figures were badly askew because nobody had died.

But several residents apparently overate seriously at our big turkey
festival, and on both the twenty-ninth and thirtieth someone died
unexpectedly.  On the first of December she appeared in my office
triumphant with her scorecard: "We made it, just as the figures
predicted."  But did you notice, she never uses the word "die."  They
"leave us" or "they pass on" or "God sent his angels for her."  At this
he snapped his fingers and asked Zorn to phone Foxworth's office and
tell her to bring her Johnny Carson video with her.

"You'll enjoy this.

Superb comedy."  Andy protested: "I don't have time for a half hour of
comedy," and Krenek explained: "It's only a few minutes.  Extremely
relevant to our work in this place.  Provides a sense of balance."

When Foxworth slid her tape into the video machine, Zorn saw on the TV
screen a fine image of Johnny Carson in one of his famous skits.  He
was the editor in chief of a publishing company that specialized in a
massive thesaurus containing a prodigious number of synonyms for any
word.  Dressed in funereal black, Carson was addressing his fellow
editors: "We have come here today to pay our last respects to one of
the finest editors we've ever had.  Gregory left us last night.  He
passed over.  He expired, drew his last breath, went to his last
reward, headed for the last home."  He continued with fifteen other
graceful euphemisms and then moved on to the vernacular: "So good old
Gregory croaked, bit the dust, kicked the bucket, cashed in his chips,
turned up his toes' and numerous other country phrases.  Just as Zorn
supposed the litany was ended, Carson moved on to robust jokes his
staff of writers must have had a riotous afternoon devising: "So, as I
say, our beloved Gregory has taken his ride in the long black, he is
wearing the white satin vest, he is helping to push up the daisies, his
toes are digging into the dust, he is paying Charon with a plugged
nickel, he's crossing the river where he pays no tax, he is gone from
us, he is kerplunk."  It was a bravura performance, one of Carson's
best, and Zorn told Miss Foxworth: "Don't lose that video.  We might
need it if things get too sticky around here."

As Miss Foxworth started to leave the office, a huge black woman whom
Zorn had not yet met, but whom he could guess to be the head nurse,
Nora Varney, arrived.  As the two women passed, the nurse edging aside,
for she knew that both of them could not pass through

the doorway at the same time, Andy had the distinct feeling that these
two women actually liked each other and that they were true partners in
the Palms enterprise.

She accepted the chair that Dr.  Zorn offered her and looked at him
with the steady, warm gaze so appreciated by the residents.  In that
moment Zorn realized that he had as his main associate a woman who was
born to be a nurse and comforter: "They tell me you're the soul of this
establishment, Nurse Varney.  I'll need your help, because I've been
sent down by Mr.  Taggart to bring this place up to running speed, and
I won't be able to do it without you and Mr.  Krenek and Miss Foxworth
giving me cooperation and guidance.  Tell me a little about yourself.
Where did you grow up?"

"Little town in Alabama."

"And you studied to be a nurse where?"

"Larger town in Alabama."

"How'd you get down here?"

"We were led to believe the streets were paved with rubies.  I got on a
bus and came down to see."

"I don't see any rubies on your fingers."

She laughed easily: "They're here, but I haven't found them yet."  As
they continued to talk Zorn was increasingly impressed by her humor and
articulateness.  If one looked only at her ample face, one might have
expected her to speak in a typical black dialect, but there was no
trace of one and he was so interested in her that he dared to ask: "Did
you consciously learn to speak without an accent?"  and she
explained:

"When I came to work in Florida thirty years ago, white people visiting
from the North thought it was colorful when I spoke with a heavy
Alabama dialect, and I had one of the best.  Still do.  But I soon
learned that as long as I clung to it, I was accepted only as a
back-country servant, colorful but not to be taken seriously.  So I
taught myself to eliminate the "Yassuh, master" nonsense and converted
myself into a real head nurse."  She broke into laughter, her wide face
gleaming with mischief: "Sometimes strangers coming to inspect the
place, they speak to me in black dialect, to put me at ease.  I never
scorn them, but I do answer in complete sentences with an accent just
like theirs, and they're smart.  They get the point, especially if
they're going to live here and discover that much of what they want
they will get through me-we get along fine."

She considered this for some moments, then added: "But at night
when I'm with old friends or family I can talk Alabama with the best of
them.  And often during the day, to make a point, I'll revert without
embarrassment, but I didn't waste those years in night school getting
my degree."  Then, apparently aware that she might be talking too much
about herself, she added: "But I still cling to one phrase used in our
family of eight.  It sounds right to me, because my mother taught me so
much about human beings while using it: "Nora, you gots to learn that
all peoples gots their own way of doin' things.  Respect 'em, don't
fight 'em."  I continue to preach from that text: "All peoples gots
their own way."  It's my tie to home."

"Keep it.  Now, what advice can you share with me to make my job
easier?"

"In my work I hear the complaints of the residents, and the thing they
will not tolerate is bad food or bad service in the dining room.

Remember, Dr.  Zorn-' "Mrs.  Varney, you're old enough to be my mother.
Name's Andy."

"Remember, they're in the dining room only once a day, most of them,
and it's a big occasion.  If you allow the cooks and waiters to mess
things up, you're going to have a very unhappy group on your hands."

"And-?"

"The part of the building we call Assisted and Extended, and don't you
ever call it the hospital, is my responsibility.  It's where we earn
our big money, so if I come to you and say "Dr.  Zorn, we ought to
repaint the hallways in Assisted Living," don't dismiss the request out
of hand.  I won't be thinking of my own desires.  I'll be thinking:
"The last two visitors who came here to see if they wanted to put their
mother in with us noticed the shabby wainscoting and turned away."  I
may really need that paint job, but I won't expect you to give in right
away.  But do study it, take a look for yourself, and try to find the
money somewhere."

He asked her what other friction points he should be aware of, and she
surprised him by saying: "You have to be very diplomatic with our house
medical adviser, Dr.  Farquhar.  The relationship between you two men
has never been spelled out neatly, not here or anywhere else.

He's tremendously important and extremely helpful, but he is not at
your beck and call.  He is not to be treated as if he were your paid

employee.  He's more like a trusted lawyer who is on what they call
a retainer.  Consult with him, don't try to give him orders, because he
won't take them, and if he turns sour on this place, he can destroy us
with the rest of the medical community.  You don't have to be nice to
me or Mr.  Krenek, but you must be nice to him, because he can be of
terrific help to us, smoothing the way with the hospitals, referring
people to us and keeping the place in good running order.  Let me put
it simply, as head nurse I could exist if you and I despised each
other, but I couldn't keep Health prospering if Dr.  Farquhar decided
it was inferior."

"Is he the best man possible for the job?"

"He's a saint.  Temper as smooth as apple butter.  Very good doctor,
and a man you can trust."

When it looked as if the interview was coming to an end, Zorn,
unwilling to lose the insight of such an interesting woman,
suggested:

"Perhaps I'd better see your domain, with you as my guide," and they
walked together down the hallway connecting to Health.  When they
reached the second floor, Andy could see that Nurse Varney was in
command, but in a benevolent way, for as she passed through the
corridors she spoke in a supportive way to the nurses, introducing them
to the new manager and encouraging them in their work.  At the door to
most of the rooms she was able to stop, look in and speak to the
occupant, using his or her name.  It was obvious that she knew her hall
and was well acquainted with its problems.

But when she and Zorn reached the third floor, Extended Care, Andy
sensed a much higher level of tension, exemplified by the nurse in
charge, a white woman named Edna Grimes who had a combative air as she
moved along the corridors almost as if she were a warden in a jail.
Zorn whispered: "She doesn't seem to like her job," but Nora replied:
"She's extremely capable.  I can rely on her to get things done."

Zorn thought that perhaps this type of personnel was necessary, for
here the illnesses were more severe and the patients more testy.  He
caught a good example of this, and the different ways Nurse Grimes and
Head Nurse Varney handled difficult cases, when they heard a rather
loud rumpus, and looked into one of the rooms to which Nurse Grimes had
hastened at the first signs of trouble.

A Mr.  Richards, eighty-eight, and weighing not much over a hundred and
fifteen pounds, was having a tantrum and making a good deal

of disturbance for his size.  Nurse Grimes was tugging him about
but Nora stepped between them and said rather roughly: "Hey!  Brother
Blowhard!  What's all the racket?"

They took my paper.  I want my paper.  Only thing I enjoy is my paper
and they took it."

"What's he talking about?"  Nora asked and Miss Grimes said:

"Cleaning people must have seen it on the floor and thrown it in the
trash."

"No wonder you're distressed," Nora said to the angry little fellow.

"I'd be, too, if they took my paper before I'd read it."  Reaching for
his phone, she dialed her office and said: "Jane, rush my copy of
today's paper up to Room 326," and this was done, but when it arrived,
Mr.

Richards took one look and threw it to the floor: "It's the Tampa paper
and I want my paper, the St.  Petersburg one.  It has more foreign
news."

Again Nora phoned her office: "Have Sam rush over to the mall and get
Mr.  Richards a copy of today's St.  Petersburg paper.  Use money from
our petty cash," and while they waited for this to be done, Nora sat on
the bed with Mr.  Richards and told him: "You raise hell like this
again, Buster, I'm gonna who mp you," and he looked up at her gigantic
size and said: "I believe you would, too.  But I do want my paper."

"Weren't you listening?  I just sent Sam to get you a copy," and he
said: "I'm not going to pay twice for what was mine to begin with."

"Mr.  Richards, my dear friend, I've already paid for it.  You were
right to make a fuss, but now settle down or I'm really gonna who mp
you."  He looked at her and smiled, and when Sam delivered the paper
with the foreign news Richards took it, thanked him and explained to
Nora and Zorn: "In my real life I worked overseas a lot, Arabia,
Pakistan, Congo, Mexico, wherever there was oil in the ground, there I
was.  Thank you."

But even Nora's relaxed style tensed when they approached Room 312,
where she stopped outside the door: This is our job at its worst, Andy.
The woman in here, Mrs.  Carlson, is practically dead, but there is no
way, legally, that anyone can take any positive step, like cutting off
support systems or stopping medication, to enable her to die of natural
causes."

"Does she know she's in the last stages?"

"Know!  Doctor, she's been comatose for more than a year.  In all
that time she's never known who she was, or where she was, or the name
of anyone who comes to visit her.  She's what they call a "living
vegetable," and I want you to see how she's kept alive."  Nora ushered
him into the room where, in a bed lined with many wires and transparent
tubes running down from a complicated gantry, Mrs.  Carlson, pallid and
passive and tormented by bedsores, spent her unheeding existence.  It
was both a miracle and a travesty of modern medicine.  She was kept
alive without her brain or nervous system sending signals for the
various body functions; they were discharged according to the dictates
of medicines or pumps or the slow drainage of chemicals into and out of
her body.

Nora commented, in a voice carefully devoid of inflection: "We are
absolutely committed by law and the customs of humanity and the
Hippocratic oath to keep her alive as long as we can, and medicine
comes up with one miracle solution after another to do this.  Her
physician, you'll meet him, Dr.  Ambedkar, an Indian Indian, is
firstclass.  He's engineered the devices that keep her going and I
suspect he thinks of her as his masterpiece."

"And what has it cost so far?"

"Counting everything, outside costs and ours and the doctors', she has
to have several of them, around two hundred thousand dollars."

"You certainly don't approve of a scene like this, do you?"

"I'm a licensed agent of the government with a sworn obligation to keep
her and all the others alive, and let me give you some stern advice,
Doctor, don't you by word or deed or even a hint go against the legal
rules or you could destroy both yourself and the Palms.  Our
responsibility is to keep them alive."

"But isn't there something called a living will?  Gives the doctors the
legal right to terminate cases like this?"

"There is.  But she didn't sign one.  And even when they do we often
find that because of some slip or other the courts find them not legal
at all.  We're on very tricky ground here, Dr.  Zorn, and don't allow
yourself to be thrown by it.  Anyway, you have nothing to say about the
problems on this floor.  Only Dr.  Farquhar can give orders, and he's
extremely careful about preserving life.  So do not try to interfere.

Only disaster can come from that."

These two compassionate officials who understood the moral aspects of
what they were discussing had conducted their analysis while standing
on opposite sides of Mrs.  Carlson's gantried bed, but she did not hear
their arguments, even though they concerned her welfare, nor had she
heard anything for the past fifteen months, a hostage to the miracle of
modern medicine.

During his third week on the job, Dr.  Zorn had two conspicuous
successes, which gave him the confidence to tell Miss Foxworth: "We may
be able to turn the corner," only to have her warn: "Each of your
predecessors told me the same thing at some early stage in his regime,
only to see the brief success crumble into dust."

But these two events prove that I can sell rooms."  He had, by
accident, come upon Ken Krenek when the latter was ineffectually trying
to convince two elderly couples from Indiana that the Palms was the
place for them.  Zorn, in passing, saw the glazed looks in the eyes of
the four Hoosiers and realized that they were soon going to terminate
their inspection.  Quietly he inserted himself into the quintet, told
the visitors how much he had enjoyed the beauty of Indiana when he
worked in nearby Chicago, and subtly brought in the names of Ambassador
St.  Pr s and Senator Raborn: "On the floor of the United States
Senate, RabOrn was a lion of rectitude and the sponsor of many fine
laws.  He and his wife occupy the suite next to the one you're
considering, Mr.  Evans.  If he chanced to come by he'd tell you what a
fine place the Palms is."

Do those two men actually live here?  Permanently?"  Indeed they do,"
Andy said, his brick-red hair glistening in the sunlight and his round
face a wreath of smiles.

"Goodness me!  Here comes the ambassador now," and he made a great
to-do about hailing the reserved diplomat:

"Sir, these good people from Indiana are inspecting our establishment,
and I wonder if you'd care to tell them how congenial you find the
place."

The Hoosiers proved to be such interesting citizens that after a few
moments St.  pres actually drew up a chair.  When Senator Raborn
happened to come looking for the diplomat, he too joined the
conversation, and forty minutes later Andy Zorn had sold his first two
apartments.  In finalizing the deal the four visitors told Zorn: "You
were so helpful.  You had so many answers to the very questions that
troubled us.  Lucky for us you came along, because if you're the
manager-' Andy accepted the compliments, for they verified what he had
promised Mr.  Taggart: The skills that enabled me to calm anxious
mothers and frightened children will work equally well with older
people."  As for Andy's second success, it began as a disaster on the
day after the Hoosier sale when Krenek and Miss Foxworth rushed into
his office with terrible news: "The Mallorys are moving out again.
There goes our biggest suite."

It was true.  The millionaire couple had hired professional movers to
report at their apartment at eight in the morning and transport
everything to a new condominium on an island in the St.  Petersburg
district.  By the time Andy reached the apartment he found it half
empty and the dancing Mallorys unconcerned as they supervised the
removal of the remainder.

"My dear friends!"  Zorn pleaded, 'how can you possibly do this?

Haven't you enjoyed yourselves here?"

"We find we're really not ready for a retirement center," Mr.  Mallory
said.

"We need a house of our own-city amenities-beauty like what the new
place has.  Your lawyers can decide with ours how much you owe us
back."  And with that they vanished, leaving the top Gateway apartment
vacant.

At four that afternoon, Zorn assembled his war cabinet and asked:

"What did we do wrong, to lose a great couple like the Mallorys?  They
were so kind to me on my first day.  I really liked them and this
failure makes me sick."

As he spoke, Krenek and Miss Foxworth looked at each other and
suppressed giggles, but Nurse Varney was willing to give her new boss
the truth: "Dr.  Andy, the Mallorys have been in and out of this place
three times.  They're here, they love it.  They see an attractive
private house somewhere, and off they go.  Six weeks later they're back
here, and the following spring out they go again."  Krenek and Foxworth
nodded in agreement.

"Then why do we fool with them?  If they give us that kind of
irrational trouble?"

Again Nurse Varney became the reporter: "When they apply to come

back in, Mr.  Krenek says "To hell with them" but Miss Foxworth
sees the buy-in money and the big monthly fees."

"And what do you say, if you're closest to them?"  he asked the
nurse.

"I say that about six weeks from now Mr.  and Mrs.  Chris Mallory will
be in this room, begging you to take them back."  She was a wise
prophet, because five weeks later the Mallorys came swinging into the
parking lot in their Cadillac to inform Dr.  Zorn that life on the
island had proved to them that they were happiest at the Palms, and
could he make arrangements immediately to let them have their customary
apartment: The big one at the peninsula end of floor seven would be
just right," and with smiles that could have warmed the entire west
coast of Florida, they reminded Zorn that it was in that apartment,
with them, that he had begun his tenure at the Palms.  And then they
uttered a heart-winning line that would become famous throughout the
center: "We're really back because of you, Dr.  Zorn.  You know how to
manage this place from A to Z."  Mrs.  Mallory paused, poked Krenek in
the ribs and asked playfully: "Don't you get it-Andy to Zorn."  Krenek
looked away in amused disgust, but Miss Foxworth could not suppress a
giggle.

At this point Zorn said: "I think the Mallorys should wait outside and
allow me to consult with my colleagues about what we should do in this
case."  As the amiable couple rose to go, expressing no displeasure at
having been dismissed for the moment, Zorn could not keep from assuring
them that he had been warmly impressed by the way they had treated him
on that first day: "We'll see what can be worked out."

When he was alone with his warring staff members he asked for specifics
that would justify Krenek's harsh opposition to the Mallorys, and
Krenek was quick to reply: They drive me nuts.  Have for all the years
I've been here.  Initially they could never agree about coming into the
Palms.  He originally dragged his feet, said he was only seventy-nine
and not about to end his life in what he called "God's warehouse."  '
"How about his wife?"

"She was two years younger, seventy-seven and absolutely fed up with
keeping a large house and entertaining his friends."

"And she prevailed?"

"Yep, they moved in, fought all the time, made people uneasy, and moved
out, with him blasting the place."

"But they came back?"

"Yep, and now it was he who wanted the easy living and she yammering
like crazy against the early dining hours.  More fights, more
uneasiness.  But always brought with them her big Cadillac.  They loved
it.  They're mad about dancing and take couples from here into Tampa
for evening dinners.  Yep, they go dancing at least one night a
week."

"So why did they leave the second time?"

"They told me that they both agreed that they were too young for the
long rest.  They wanted their own small apartment, their own eating
hours, their Cadillac and their dancing.  This time you should say
no.

Because, sure as blazes, six months from now they'll want out again.

Too much wear and tear on the system."

"But Miss Foxworth, you say bring them back in?"

"I do.  They want their big apartment back, and I believe I can
negotiate a hefty buy-in.  They're loaded, and I think they'll go for
it."

"Don't they have any children to express an interest in what they
do?"

Zorn asked, and Miss Foxworth said: The children, in their fifties, are
a messy lot.  They signed the contracts the first two times and I found
them detestable.  They haggled over every penny.  The good part about
the proposed deal this time is that the children are not involved.  The
old folks told me: "This will probably be our last home.  We'll
engineer it ourselves," and they're ready to sign."

"For how much?"

"It's a two-hundred-fifty-thousand-dollar buy-in, so that, plus the
monthly fee, would represent a lot of income.  If I can't negotiate
with them I know you could.  They told me one of the reasons why they
wanted to come back was that you gave the place class.  They were never
happy with Mr.  Krenek."

"Nor I with them," Ken said.

"And I warn you, Andy, if you do allow them in, you'll face a messy
situation before long.  They'll want out and their money back."

Zorn, feeling that he understood the facts and the sensible, though
contradictory, opinions of Krenek and Foxworth, asked Nurse Varney to
call the Mallorys back into the meeting.  When he saw the cheerful
pair, totally unaware that they had been behaving foolishly, he had to
smile, for he liked them and felt sure there was a place for them in
the Palms, if only they would behave reasonably.

As if he were a benevolent schoolmaster consulting with high school

students who had been temporarily suspended, he opened the session
with a conciliatory question: "Why would you good people want to come
back a third time?  When you left us before in such disdain?"

Mr.  Mallory spoke: "We realized that all our real friends are here.

When you reach ninety there aren't too many left out there."

"And you think that this time you might make it stick?"

She spoke: "In here you can always find a bridge game, and that's not
so easy out there."

"You brought your Cadillac with you?"

"Never be without that," she said.

"And Chris still has his little Pontiac.  Think how tied down you'd be
without your car when you grow sick of the place and want to drift
off."

"So even as you apply for readmission," Zorn said, 'you confess that
one of these days you'll want to drift off again?"

"I meant on a day-to-day basis.  For the long haul, I don't see how we
can do much better than right here."

Mrs.  Mallory said: "The truth is, Dr.  Zorn, he became worried about
how he could celebrate his ninetieth birthday out there.  Who would
come?  All our friends are here, built in, can't escape."

"I understand you have children, grandchildren.  Certainly they'd be on
hand.  Ninety years, remarkable."

Chris Mallory answered sadly: They are not the kind of people one would
elect to have at one's celebration.  They're shocked and say so,
repeatedly, that we still go dancing.  To tell you the truth, Dr. Zorn,
we were drawn back here as if huge magnets were pulling at us."

Mrs.  Mallory looked at Krenek, and laughed: "Let's confess it, Chris.
The trouble the other two times was that we were too young to
appreciate the good things we had here.  Now that we're older, and I
must say, wiser, the place looks much more attractive than it did last
time.  Am I to understand, Miss Foxworth, that we might have that fine
set of rooms with the big windows we had before?"

That's up to the management.  Your record here isn't very good, you
know."

"We're talking with the management, aren't we?"  Mrs.  Mallory asked,
staring brightly at Dr.  Zorn.  Her husband said: "We know Mr.

Krenek's against us, but Miss Foxworth knows that we pay on time, and
handsomely, so isn't it up to you, Doctor?"

Zorn found it easy to reach a decision.  Turning to the Mallorys, he

said: "I like your style.  A place like ours profits from your
presence.

You inspire our older members and, quite frankly, you inspire me.  But
this time you have to stay put.  We want two full years' fees in
advance."

Then, with everyone smiling, he added: "You two really are a pair of
yo-yos, but now you have to settle down."

"Done!"  Mallory said.

"Miss Foxworth, prepare the papers, and this time it's for keeps."

"That's good of you, Mr.  Mallory," Miss Foxworth said, 'but it's the
first part that will be of greater importance to us, two years'
guaranteed occupancy by you, with fees paid in advance.  Those who
don't call you the Yo-yos call you the Dancing Mallorys, and we don't
want you dancing out of here as soon as something displeases you."

"As we grow older," Mallory said, 'we grow more tolerant.  And with
three experts like you to keep this place in good condition, you'll
find us helpful, too."

With gracious smiles they shook hands all around.

"Can we move our furniture in this afternoon?"  Mrs.  Mallory asked.

"Since the pieces have been here twice before, we know they'll fit,"
and Mr.  Mallory asked if the office machine could run off fifty copies
of their announcement of a welcome-home party to be given in their
apartment the next afternoon at three.

"Inviting our neighbors back to resume the good old days."

When they were gone, Zorn told his colleagues: "I'm sort of dizzy.

You've really had to swing and sway with that pair, Ken, haven't
you?"

The welcome-home party the next afternoon turned out to be a raucous
affair.  Because too many residents wanted to attend what they knew
would be a first-class bash, it had to be moved from the Mallorys'
apartment to the recreation area, where two waiters serving as
bartenders dispensed so many alcoholic drinks that an observer might
have thought he was attending a bacchanalia.

The highlight of the party came when Ken Krenek appeared in a chef's
costume to supervise the serving of an excellent pizza, Buffalo wings,
Vietnamese egg rolls with paper-thin crust, and skewers of chicken
liver and Indonesian sate.  Zorn, watching his well-to-do residents
devour the food and guzzle the booze, thought: How nice we're having
our own little saturnalia.  But his mood darkened a bit when he saw
that the widows, living on retirement funds more restricted than the
Mallorys', were not drinking but were choosing with care the most

healthful food items: "They're getting a free feast, so they won't
have to pay some restaurant for that day's second meal," and he smiled
indulgently as many of them slyly slipped extra servings of meat into
their handbags to eat later.  He felt pleased that his center could
accommodate both the wealthy and those of more moderate means.

When Dr.  Zorn had made his initial tours of his new command, he had
quickly learned that Gateways, the retirement area of the Palms, had
two focal points around which life revolved.

First was the reception desk inside the main entrance where messages,
mail and telephone calls were distributed to their proper recipients.
An African-American woman with an IQ of nearly 200 and an unflappable
disposition masterminded this battle station and exerted iron control
over postmen, parcel-delivery people and inhabitants.  Her name was
Delia, and both Dr.  Zorn and Mr.  Krenek deferred to her when the
orderly administration of traffic into and out of Gateways was
involved.  She handled about fifty crises an hour and was able to
resolve most of them without losing her temper.

The other focus was the dining room, a spacious, well-organized area
containing thirty commodious tables and big windows overlooking both
the pool to the south and the channel to the west.  Carpeted and with
its ceiling lined by soundproofing material, it was a quiet room,
decorated in equally quiet pastel colors and filled with sturdy oaken
tables, each with four armchairs.  Since a table could hold only four
diners, the room could obviously seat no more than a hundred and
twenty; a long table near the door could seat ten more.  But since the
Palms had accommodation in Gateways for several hundred residents,
there had to be an additional dining room, but it was a small affair
frequented by residents who wanted to dine early at five o'clock or
even four-thirty.

The master dining room opened at half past five, an hour that almost
every newcomer protested but to which he or she quickly adjusted,
forgetting that in civilized society one dined at seven or even eight.
One dined early at the Palms or one ate in one's room.  Breakfast and
lunch

were also served, of course, but since monthly fees covered only
one meal a day, almost everyone opted for dinner, so that the main room
was usually filled to capacity in the evening.

The room came to life at a quarter past five each weekday night when
hungry inhabitants lined up early to assure themselves of choice
seating and hot food.  By ten minutes to six, the room was buzzing.  In
addition to its tasteful decorations based on a Mediterranean theme,
the room was filled, as one elderly woman said, 'with those adorable
high school girls, and the boys, too, who wait tables."  As Zora
learned, the Palms had an arrangement with two nearby high schools
whereby seniors in training for food-service occupations would work six
evenings a week as waiters and waitresses and earn a wage, which, if
saved, could pay much of their first-year tuition at one of the nearby
junior colleges.  They were a handsome lot, seventeen and eighteen
years old and well trained by the Palms staff.  With surprising speed
these youngsters memorized the names of many of the residents, who in
turn mastered the names of the young people so that the room resembled
more a family gathering place than a restaurant.

Residents were not assigned specific tables; they were expected to
drift in as they wished and sit at a different table each night, which
meant that one dined with someone different most nights of the week.

Usually two married couples occupied a table, but since there were many
widows and widowers, some tables might be composed of four unmarried
persons, and they did not have to be two men and two women.  They could
be any mix, which made for warm socializing.

There was also that one long table at the western door, and here lone
people were invited to dine together in general camaraderie.

The room looks so civilized," Zorn told Krenek after his third
inspection, 'that we ought to have flowers on different tables
throughout the week."  Ken objected: That would cost money," to which
Zorn replied: Take it out of my floating fund," and in the following
weeks the room looked even more inviting.

When Andy first circulated through the hall he had noticed an anomaly.
All the tables were either small squares seating four, and the long,
rectangular No.  29 seating ten, except for one round table, No.  4, in
the extreme southeast corner.  He tried to deduce its purpose.  It
could seat five, but on most nights it held only four occupants who
appeared to be, like those at the other tables, a mixed lot.  On some
nights, however, the same four men occupied the table, apparently
in deep conversation.

Unable to decipher the pattern of occupancy, Zorn finally asked Krenek
as they stood at a vantage point from which they would probably not be
seen: "What's the story on number four?"  and the administrator
chuckled: "You might call that the pride of the Palms.

The four men who often sit there are our tertulia."

"Our what?"

"Spanish word.  The tall, distinguished-looking man who always sits in
the corner leading the discussion is the Colombian gentleman I told you
about, Raul Jimenez.  Very capable newspaper editor in Bogota.  Won
medals and such, internationally, too."  Zorn studied the very thin,
austere-looking foreigner, a courtly gentleman with a finely pointed
goatee.  He could have been painted by Velazquez, so essentially
Spanish he appeared, and so like a grandee of the royal court, for he
held himself stiff and proper.

"Why did he come to the U.S.?"  Zorn asked and Krenek whispered:

"Exile.  When he was run out of Colombia, Harvard University gave him a
position teaching Hispanic culture.  His lovely wife, Felicita, came
with him when he retired.  They usually dine together except when he
convenes the tertulia."

"And what is that?"

"An old Spanish word meaning an informal club that meets in the corner
of some restaurant or bar.  Eight, ten men of some local importance who
like to discuss politics, poetry, philosophy.  The heady topics!"

"The other men?  Are they regulars?"

"Yes, and you might say they're the brains of our establishment, the
ones with reputations that have spread beyond Florida."

"For example?"

"Going counterclockwise, the big muscular man with the shock of gray
hair, that's Senator Stanley Raborn, the Silver Fox of the Prairie.

Nebraska Republican, powerful orator like the old William Jennings
Bryan, also from Nebraska.  He's frequently summoned to policy meetings
in Washington or cities like Chicago or L.A. His name was placed in
nomination three times for vice president.  He would have run as
Goldwater's VP but they felt they needed a geographically balanced

ticket, and Barry took that congressman from New York.  A bad
mistake in my opinion."

"He looks to be a toughie."

That he is.  But he can also be deceptively gracious, especially when
he's about to do you in.  Don't take the senator lightly."

"I'll be on guard."

"The handsome, bald-headed man to his right, the one who looks like an
English duke or the colonel in charge of a Scottish regiment, that's
Ambassador Richard St.  Pres, pronounced Pray but spelled Pres.  He
served in many countries, but made a name for himself in Africa.  I
forget what he did, but there've been articles about him.  Very
courageous.  He's important but now retired."

Zorn whispered: "It would be interesting to hear his stories of
diplomatic intrigue."

"The last one is the man everybody loves.  President Henry Armitage
from a small college in Iowa.  Treats us all as if we were his students
and isn't at ease until he's satisfied we're all OK and out of
trouble."

Zorn said: "He looks like Edmund Gwenn in that Christmas movie about
Macy's," and Krenek said: "Not strange you should say that.  He serves
as our Santa Claus each year, here and in one of the elementary
schools."

Inspired by the jovial president, Zorn himself became protective of his
charges: "Dining alone that way?  Don't they have wives?"

"Jimenez and the senator do.  St.  Pres and the college president
don't.

But I understand the wives encourage their husbands to attend the
tertulia.  They say their men need academic discussion to retain their
smarts."

"Do they discuss set topics?"

"Heavens, no!  Their table seats five.  That's so they can invite an
interesting visitor or other residents who might have something sharp
to contribute.  You'd be welcome to join them.  I'll fetch a chair."

And in that easy way, Dr.  Zorn joined the tertulia, sitting between
President Armitage and Raul Jimenez.  The topic they were discussing
was one they'd been considering for a large part of the year, returning
to it again and again, for it was a subject of intense interest to men
of their advanced ages, each well past seventy.

"We've been wrestling with that ugly word "triage," the senator

explained.

"Can we afford to provide first-class medical services to everyone in
the nation who wants them, or will we be forced to ration the costly
new machines like the MRI and expensive treatments like coronary
bypasses?"

Before Zorn could respond, Jimenez said: "They tell us you're a doctor.
Your opinion would be valuable."

"I'm not licensed to practice here in Florida, you know.  But I
certainly was a doctor in Chicago, an obstetrician, and the problem you
just denned came up constantly-at the beginning of life, not at the
end, where we know about the costly procedures."

"What could have been a situation in which a baby doctor faced the
problem of triage?"  President Armitage asked, and Zorn explained: "I
faced it almost every day.  Let's say a baby is born to an unmarried
sixteen-year-old girl already infected with AIDS, and an alcoholic to
boot.  The baby girl is premature, I've seen scores of them.  The child
is doubly at risk, for AIDS and alcoholism, and she has only a slim
chance of surviving or amounting to a real human being if she does
survive.  But we spend maybe two hundred thousand taxpayers' dollars to
keep her alive, knowing she'll probably be dead by the time she's
eleven.  Does that make sense?"

Eagerly the men started to dissect this new information, for hitherto
they had focused mainly on choices facing the aged.  President Armitage
observed: "That deplorable case is easy to decide.  You don't hesitate.
The fetus is surrendered before birth."

"Not so fast," Zorn said, entering the spirit of the tertulia, where
opinions could be shared, defended and rebutted without giving offense.
The decision can become very dicey if the evidence is not clear."

"But it seems so open and closed," Armitage insisted.

"The baby is doomed-can never enjoy a normal life," and Zorn replied:
"But obstetricians know that even an infected mother can sometimes give
birth to a normal child, whom we can save in our prenatal units.  You
never terminate a life casually."

"Indeed you do not," Jimenez said.

"Doctor, I applaud you for your common sense."

President Armitage, determined to keep the argument focused on
alternatives faced by ordinary people in their real lives, said:
"Surely you must have had, in your practice, situations in which normal
people faced decisions that produced anxiety.  Share one with us."

Zorn reflected for a moment, then asked: "I suppose you know about
the miracle of amniocentesis?"

"Yes," Raborn said.

"We had a Senate hearing on procedures like that.  You can extract
fluid from the womb and detect genetic abnormalities in the unborn
fetus.  Extraordinary."

"Correct.  Now I want you to imagine yourself as a young husband whose
wife is pregnant for the first time.  But there's a suspicious record
in her family of irregular births.  So to be safe we run the test and
find that the fetus seems to have an extra Chromosome twenty-one.
Down's syndrome.  A baby like that can produce agony in a family."

Jimenez, a devout Catholic, protested: "Don't stress the agony,
Doctor.

I've known several families who reared such babies and found great joy
in doing so."

"Granted," Zorn said.

"But the child usually dies in his or her early twenties having caused
considerable expense in both money and emotion.

Is it worth the dual investment?  To save a life that can never be a
life?"

"Completely unwarranted," snapped President Armitage, who was a
tough-minded realist despite his Santa Claus appearance.

"I'm surprised you even pose the problem."

"I advance it for two reasons.  First, the accuracy of the test is not
one hundred percent.  What if you're condemning a child who might have
proved normal?  Second, there's the religious factor."

"How does that operate?"  Armitage asked, and Zorn explained:

"When a couple faces its first pregnancy, it's a mysterious affair.
They tend to grow more religious, especially the women.  This is God's
blessing on their union and there's a strong desire to accept His
judgment: "If He's giving us a damaged child, it must be for some deep
purpose we don't understand."  So they allow the baby to be bora and
more than half the time it's severely retarded."  He ended his sentence
in a very low voice, and for a moment the table was silent.

Senator Raborn, who in his public life as an interrogator had fought to
obtain clear, simple answers, asked: "So where does that leave the
couple with the pregnant wife?  What problem do they face?"

"Abortion."

"No, no!"  Jimenez protested.

"I oppose abortion."

"So do I," Zorn said.

"In ordinary cases.  To make it easier for a

careless couple.  Or as a form of birth control.  But in this it
would be a therapeutic abortion, recommended by careful medical
practice."

"I'm in favor of that," Senator Raborn said.

"It seems the practical thing, to correct nature's accident."

"God does not make mistakes," Jimenez said.

"The Down's syndrome child can bring powerful love to a family. Parents
and siblings alike, they unite to nurture the unfortunate and become
better human beings in doing so."

St.  Pres said quietly: "When you've served in the underdeveloped
countries of South America and Africa, you look on therapeutic abortion
in a different way.  It seems the humane way to go."

"Never humane!"  Jimenez said firmly, the long tradition of his
Catholic heritage coming through.  Then, as if conducting a debate in
some parliament, he placed his hands flat on the table and reminded his
tertulia: "We were supposed to be discussing triage.  What's your
medical reaction there, Doctor?"  And he pronounced the title with all
the reverence that citizens of the Latin American countries feel toward
their medical men.

Zorn said: "I side with the senator.  Cost alone will demand that we
ration health care.  And that throws us into value judgments, severe
moral dilemmas."

"Who will make such judgments?"  President Armitage asked, and Raborn
said sharply: The public.  Through discussions like this, and public
statements by our leaders including the church and the economists,
we'll reach a consensus."

"And when it is reached," St.  Pres said with an almost cruel
insistence on facing the truth, 'seventy percent of the operations
performed on people like us in the Palms will be declared nonessential.
They'll be forbidden in the regular system, but remain available
through a black market, which only the rich will be able to afford."

Such a conclusion disgusted Armitage, who rebutted with considerable
force: "So you'll ration health needs by the standard of the
pocket-book?"

"Has there ever been any other way?"  St.  Pres insisted.

"Isn't that what we do now?  Tell us, Dr.  Zorn, could a married couple
of modest means gain entry to this establishment, and the good health
advantages you provide us?  Are your services not rationed by our
pocket-books?"

Zorn took a deep breath, for he did not yet know how much power the
ambassador wielded in the establishment, but even so, he was not afraid
to answer: "You may be surprised to learn, Mr.  Ambassador, that we
have three widows now occupying single rooms who used to live in
expensive duplexes when their husbands were alive.  They've fallen on
bad times, the poor women.  Their husbands weren't as rich as they both
thought they were.  We figure that our corporation made a decent profit
from such a family while the husband was alive, and so we carry the
widows on our books at a very low rate-very low indeed."

"So you're practicing your own version of humanistic triage," President
Armitage said enthusiastically, pleased to hear that their corporation
had a semblance of a heart, and St.  Pres conceded: "I suppose that's
the way it will always work.  Strict rules governing priority, but
subtle ways, often secret, for circumventing them."

"But ultimately," the senator warned, 'it will have to come down to the
available dollars.  Ultimately someone will have to choose who shall
live and who must allow nature to take its course."

"I know this about triage," Armitage said.

"If I'm driving my car carefully, sober, eyes on the road, and a
situation over which I have no control suddenly explodes-three children
running onto the road over here, an elderly man with a cane occupying
half the road over there, and I have to make a split-second decision, I
will invariably head away from the children and instinctively allow the
car to plow into the old man.  He's had his life.  He's done whatever
good he's going to do.  The children have sixty or seventy or even
eighty years ahead of them in which to accomplish miracles."

"Easy choice," Ambassador St.  Pres said quietly.  Three young
children, one old man.  Let's make it one child about whom you know
nothing.  And an old man living in a district of some affluence.  He
may have made a tremendous contribution, maybe he still does.  Then
where do your reflexes direct you to steer?"

Armitage did not hesitate: "Not even a moment's hesitation.  I'd rub
out the old man.  And I'll tell you why my reflexes are conditioned to
respond like that.  As a college president I never lost sight of the
fact that the freshman boy, just in from the farm and starry-eyed with
vast ambitions, was a damned sight more important to my college than
some sixty-year-old professor whose dreams were now dead.  That's

how I was conditioned to think, and that's how I'll always respond,
automatically."

"But if the freshman is destined to flunk out at the end of his
sophomore year," St.  Pres asked, keeping the pressure on, 'and the
doddering old professor has the capacity to leave your school two
hundred thousand dollars if he's allowed time to draft his will-if you
don't rub him out prematurely-then what?"

President Armitage said very slowly: "Then debaters like you and
senators like Raborn will draft the new procedures for establishing
human values, and may God have mercy on all of us, for humanity will
have been sacrificed to greed."

"No," the senator replied in an equally controlled voice.  The budget,
inescapable from the moment of birth till the instant of death, will
have dictated the value decisions."

Dr.  Zorn, though impressed by both the gravity and the civility with
which these men argued, felt that the time had come to add a
lighthearted note.  Turning to Jimenez on his right, he said jovially:
"I've noticed that you always sit in that corner chair.  Is it your
good-luck spot?"

The Colombian intellectual gave a surprising answer: "Two reasons.

First, sitting here I can watch the pretty girls as they float about
our dining room.  Second, when you've edited a newspaper in Bogota and
traveled frequently to Medellin, you learn always to sit with your back
to the wall, and in a corner like this I have my back to two different
walls.  Double precaution."

That session of the Palms tertulia ended with the members' assuring
their new manager that he would be welcomed back at later meetings when
the discussion would probably focus on some less morbid topic.

Dr.  Zorn had now enjoyed a series of triumphs in getting the two
Indiana couples to enroll in Gateways and in welcoming the affluent
Yo-yo Mallorys back into their big apartment, and on his terms.  But he
had accomplished nothing in his real problem area, filling the beds in
Assisted Living.

But now he was about to achieve an outstanding victory in that field,
not because he had been especially brilliant in setting it up but
because a used-car dealer from Sarasota had to go to the men's room. 
The fortunate accident was set in Train one day as Andy sat in his
office biting his nails, studying a report on what the Palms was
spending on advertising for Assisted Living and the meager results the
ads were producing: "Krenek, there's got to be a more effective way of
bringing patrons in here to Assisted."

"You have to keep your name before the public.  Otherwise you slowly
die."

"Granted.  But you don't always have to do it in the same old way.

Tell me.  Who is our ideal prospect?"

"For what?  Residence in Gateways or temporaries in Health?"

"Gateways takes care of itself.  Long-term assured growth.  Over here
in Health is where we make our money.  Who's our target?"

Krenek thought for a few moments, then spoke judiciously: "First of
all, someone with above-average income.  Stable family but not rich
enough to afford round-the-clock private nurses.  An accident happens?
An operation is necessary?  A temporary bed here is their ideal
solution."

"I know, but explain who these people are."

"Upper-class but not elite.  What you might call upper-upper."

"What are they like?"

"The men go to work in offices.  They belong to luncheon clubs like
Kiwanis.  They play golf.  And when older family members get real sick,
toward the end, they want to get them into a center where they'll get
good care.  They aren't afraid to spend money, these people, especially
on parents who've been good to them.  They love them, but they do want
them out of the house."

Andy was reflecting on something Krenek had said: "Kiwanis, aren't they
something like Rotary?  Which has more prestige?"

"I think you'd have to say Rotary, at least in this part of Florida."

Without further comment Zorn said: "We're going to invite Rotary clubs
to have their meetings here.  We'll give them free dinners."

They meet at noon."

"Good.  Luncheons are cheaper," and Zorn's plan was set.  From the
start it began to produce results, for when these men of upper
management saw that the Palms had a touch of class they began
recommending it to friends who needed health services for the elder
members in their families.

The operation was simple.  From a list of Rotary clubs, Krenek selected
one nearby, telephoned the secretary, extended the invitation and set a
date.  Then Andy told the kitchen staff: "Wednesday noon.

Rotary lunch.  Important to us, so serve an extra fine meal.  There'll
be tips."  The Rotarians, enjoying the break in their routine and a
chance to inspect a different operation, completed their club business
with dispatch and listened to Zorn deliver what he called 'a low-key,
no heavy-breathing, soft-sell description of the Palms," after which
the men were taken on brief tours of the health-care units.  The
procedure required only eighty minutes from the Rotarians and less than
five dollars a plate from the Palms.  As the men finished their meals
they saw a box labeled: FOR OUR HELPFUL WAITERS, and many who had
enjoyed the food tossed in dollar bills.

Zorn's strategy worked, because although he could not point to a single
instance in which a Rotarian, after a free meal, brought a member of
his own family to the Palms, he knew that the men did talk to others
about the two health services, and several families in the area who
enrolled elderly relatives did say: "We heard about you from our
neighbor who attended a lunch here."  When careful calculations were
made, Zorn and Krenek reported to Chicago: The Rotary lunches pay
handsomely.  Assisted Living is slowly beginning to bloom."  But one
such gathering brought an unexpected surprise.

Krenek had invited a club from the Sarasota area and was pleased with
the number of apparently well-to-do men who traveled north to visit.
The meeting started well, but just as Dr.  Zorn was ready to launch
into his spiel an excited Rotarian who had slipped out to go to the
men's room came bursting back: "Hey, fellows!  Guess who I just met out
in the hall!"  He brought with him an old man of singular appearance,
for despite his advanced age, the slump forward in his hesitant walk,
and the cheapness of his sports shirt and trousers, he had the slim
figure of a rigorously trained athlete who had not allowed the years to
pile on excessive weight.  Dr.  Zorn knew him only as Mr.

Bixby, but now the Rotarian who discovered him was excitedly addressing
the luncheon: "Fellow Rotarians, this man is one of the alltime great
baseball players, Buzz Bixby of the immortal Philadelphia Athletics of
1929, '30 and '31.  A computer study has just decided that

they were perhaps the premier ball club of all time, because of
their fabulous pitching staff," and without notes he reeled off the
names of that incomparable staff: "Grove, Earnshaw, Walberg, Rommel,
John Picus Quinn and Howard Ehmke."  As he mentioned each name, the old
man nodded approvingly, for with his bat and glove he had helped them
win their games: "And among these immortals was Buzz Bixby!"

"What's his story?"  Zorn whispered and Krenek explained: "His admirers
found him in a flophouse without a dime, so they put together a fund to
buy him life occupancy in one of our less expensive one-room jobs in
Gateways."

"Was he pretty good?"

"Hall of Fame."

"How old is he?"

"Approaching ninety, but he still has all his marbles."

"And his physique," Zorn said admiringly.

"Does he give us any trouble?"

"He's a teddy bear.  Everybody loves him."

Now the man who had found him wandering in the halls made the formal
introduction: "I've persuaded Buzz to tell us about that unforgettable
afternoon when he achieved immortality."

Standing tense and poised as if waiting for a fastball from some Yankee
pitcher, the old fellow began what Zorn accurately judged to be a set
speech; a sportswriter who admired him had gone to the record books and
composed several flowery paragraphs that depicted that long-ago game
and Bixby's role in it.  Having given the speech many times, he had
learned how to deliver it with maximum effect.  The sportswriter had
coached him on one important point: "Buzz, you mustn't sound boastful.
The facts are powerful enough, so you can afford to start low-key and
self-deprecating."

"What's that?"  Buzz had asked.

"Sounding like you don't know you're a hotshot.  It can be very
effective.  Start with exactly these words, and you'll win your
audience right at the start."  Now, speaking to the audience at the
Palms, he obeyed instructions: "Some who are entitled to have an
opinion believe it was the greatest game in the history of baseball,
but I've seen better on television."  He knew the competing teams, the
year and even the specific dates of memorable games: "Bobby Thomson's
one-out homer against Ralph Branca, Wednesday, October third, 1951,
that won

the National League pennant, or that grand World Series, Boston
Cincinnati sixth game, Tuesday, October sixth, 1975, with Carleton Fisk
dancing around the bases in the eleventh inning.  But what I am about
to relate was the greatest single inning in baseball, with no one
qualified to cast a negative vote."  The effect of these polished words
was sobering, for his listeners could see that the old man meant to be
taken seriously.  But then, using a tactic he had found effective, he
turned away from the words the sportswriter had written for him and
dropped to the street accents of his youth.

"Can't never forget it.  Columbus Day in Philadelphia, 1929.  World
Series fever.  The A's and Cubs locked in a duel.  Saturday game
allimportant.  We win, we gotta near lock on the world championship.

They win, they surge on to take it all.

"As I'm leavin' home for the ballpark I'm stopped by Zingarelli, who
runs the sandwich shop: "Buzz, you gonna have a great day."  So I
ask:

"You the prophet now?"  and he says: "Columbus Day, ain't it.  All us
Eyetalians got power this day.  You gonna be hot."

"So I thank him, but when the game starts I think: That crazy Eyetalian
don't know from nothin', because we can't get men on base let alone
around to score, while Chicago is runnin' wild.  They rack up two runs
in the fourth and explode in the sixth with five runs.  And in the
seventh they add another to insult us.  Score them eight, us zero.  And
no sign of us bein' able to change things, because their pitcher
Charley Root ain't throwin' baseballs, he's throwin' BBs.  We can't
even see 'em let alone hit 'em.  Game is lost and we're in deep
trouble."

At this point in his recollection of that historic day, unequaled in
World Series history, Buzz allowed his entire body to relax in
despair.

Hands, fingers, shoulders, head all displayed the grief of a
professional athlete whose team has collapsed, and he looked so forlorn
that Zorn felt sorry for him, a fine fellow who had thrown away his
chance for the world championship.

Suddenly everything changed, for he judged that he should return to his
prepared speech.  Straightening his head, stiffening his jaw, and
making his eyes flash, he kept his voice very low and with increasing
volume delivered the lines he liked best: "But our A's were not dead.

Slowly, like a summer storm about to explode in fury, we began to chip
away at our overconfident enemy with a determination never before seen.
The miracle happens slowly, nothing dramatic to scare Chicago,

just a scratch hit here, another there until they realize, too
late, that the full storm is upon them."

An imposing figure, he returned to his own words: "Al Simmons nudges a
home run over the wall, saves us from the disgrace of a shutout, but
that makes it only eight to one.  Foxx gets a hit.  Bing Miller slips
one through the middle.  Another scratch hit and I come up with two on
and the score eight to two, still their favor.  I shoot a hard one
toward second, where Rogers Hornsby, greatest second baseman of all
time, dives for it and misses by one inch.  I'm safe and two runs
score.  On and on our bats rattle out hits like the spatter of
raindrops in June, so that when I come up for the second time in the
inning, again we have two men on, and this time I hit a Texas Leaguer,
you know, a short pop fly just past the infield.  Now the best man in
the majors to handle a Texas Leaguer is Rogers Hornsby, but this time
he gets a slow start on his famous backpedal and again he misses by one
inch and again I bat in two runs.

"At the end of that famous inning we have ten runs, unbelievable, and
the victory.  And our luck holds, because next day we go into the
bottom of the ninth trailing two to zero, but like before we start
pecking away and win the game three to two, and wind up the series four
to one, favor of us."

Recalling those miraculous days when he was twenty-two and champion of
the world, he stopped being a garrulous old raconteur and finished with
an effective parable penned by the writer: "And so we see that we are
the toys of fate.  Chance determines so much of our lives, as my case
proves.  I keep with me photographs of my two hits in the wild inning.
They show Hornsby missing my grounder by less than an inch and my pop
fly, same margin.  An inch and a half in his favor, I'm a bum.  An inch
and a half my way, I'm in the Hall of Fame.

Chance does direct all."

The light faded from his eyes.  His voice returned to its
characteristic rumble, and once more he was eighty-eight years old,
enjoying a Florida retirement complex paid for by admirers who felt
that they too had shared in the glory of that distant Columbus Day in
1929.

Although Zorn was mesmerized by Bixby's talk, he was not entirely happy
with it, for the old hero had talked so long that he denied Zorn a
chance to deliver his sales pitch about the Palms.  But the lunch was
not a loss: the Sarasota club members told so many of their fellow

Rotarians in south Florida that the great Buzz Bixby was residing
at a rather neat place called the Palms that they began telephoning to
see if they might hold one of their meetings where Buzz could address
them.  So many asked that Zorn had to say: "We'd be honored, but we
can't keep doing this for free," and the various clubs gladly paid for
their lunches.  Zorn also organized a program so that he was assured
ten minutes at the end to speak about the Palms.  As the weeks passed
he found that he was listening to Buzz so often that he had memorized
the speech and would catch himself reciting as he went about his
duties:

"Some who ought to know are of the opinion that it was the greatest
inning in the history of baseball," so he made an adjustment in the
schedule.  He spoke first, then had Krenek hurry in: "Dr.  Zorn!
Important call from Chicago," and out he scurried.  Although he and
Krenek did notice that patronage from the Sarasota area had increased,
in his March report he could not yet tell Chicago: The Palms is now in
the black."  But he would keep working.

One of Andy Zorn's most reassuring experiences at the Palms was his
discovery that John Taggart had told him the truth about the man he
would be working with.  Ken Krenek had a remarkable ability to work for
those above him.  He studied their habits, their preferences, their
weaknesses and their vaulting ambitions.  He then asked himself: What
can I do to help this man achieve the best for both of us?  He seemed
to have neither vanity nor envy.

At fifty-four he was the epitome of indispensable service, as
exemplified in that marvelous word factotum (from the Latin facere, do,
and totum, everything).  A smiling pragmatist, he had the job of
keeping everyone happy, which meant that he was on call a good twenty
hours each day.  A leaky faucet was brought to his attention at
midnight, and a bus arriving fifteen minutes late for a scheduled
nine-in-the-morning start was sure to result in telephone calls to Ken,
as he was generally called.  He arranged for guest quarters when
relatives visited residents, found dentists and ophthalmologists when
needed, and arranged tours to museums and parks and places of unusual
interest in the Tampa-St.

Petersburg area, work for which he was applauded by his
appreciative guests.

But he was also in charge of two functions that brought the most
protests from the residents: he allocated parking slots, a thankless
task, and he was in charge of the food program, especially the
operation of the dining room.  Since only one meal a day was served to
the majority of the people, the problem of feeding could have been
considered secondary-quite the opposite, it was a constant challenge
and a constant woe.

Parking at any retirement center throughout the United States is
usually difficult for several reasons.  First, the kinds of people who
enroll in the centers are from families of more than modest means, and
they are apt to have two cars, whereas the centers have been built on
the supposition that the occupants of each apartment will have only one
car.  Thus there is a fundamental problem that can never be easily
solved; there simply is never enough room for all the automobiles, and
attempts to wedge in a dozen unexpected new arrivals becomes an
impossible task.  Second, strong-minded people with two fine cars want
them parked side by side and raise all sorts of protest when one car is
assigned a choice spot and the other a corner of a more distant parking
area.  Third, in an upscale place like the Palms, the car or cars
represent not only the most valuable but the most important item that
the couple bring with them because cars are a vital necessity in
day-to-day living.

On several occasions couples had moved out, demanding refunds,
primarily because the problems of parking could not be solved.

Krenek told Zorn at the conclusion of one unresolved battle: "We should
mail brochures only to couples with one car, and it has to be a
European mini-mini.  No Cadillacs, no Lincolns and, for heaven's sake,
no elongated station wagons."  Then he ridiculed his own suggestion: "I
know we exist on the occupancy of people with two big Mercedes or
Jaguars, but have you given serious thought to the possibility that all
places like ours might one day have to erect three-level skeleton
garages?  Don't laugh.  I can't see any other solution."  When Zorn
pointed out that they had all that open land in the savanna, Krenek
replied: "But our residents are older and not very surefooted, and
they're willing to walk only so far to get to their cars.

Andy, this is one hell of a mess and I see no easy solutions-fact is, I
don't see any difficult solutions, either."

In supervising the dining room Krenek enjoyed more success.  A
health fanatic himself, with a partiality for fish, poultry,
vegetables, salads and whole grains, he, with the help of his
cooperative staff in the kitchen, offered a menu that was both diverse
and healthful.  In a printed menu that changed radically from day to
day, he offered for the evening meal a soup, a meat dish, a fish
course, three vegetables and, to the delight of almost everyone, a huge
salad bar filled with lettuce, pickles, sliced tomatoes, fruits,
croutons, applesauce, pineapple cubes and other appetizing foods.  Some
relatively abstemious residents had only the soup, the salad bar and
dessert with a large glass of one of the many beverages served every
evening.  Some of the men were especially fond of the mild lemonade.

One would suppose that with a menu so varied-a different meat course
every night through an eleven-day routine-that there could be few
complaints, but Krenek was bombarded by two recurring protests that
could at times grow rather heated.  The first concerned dining hours.
In retirement areas throughout the nation, it had been decided, as at
the Palms, that the ideal hour for the evening meal was five-thirty in
the late afternoon, and for a variety of reasons.  The diners were
older and did not want protracted dinners.  Many of them wanted to
watch the MacNeil/Lehrer Newshour at seven and would leave the dining
room in time for it.  The high school boys and girls who waited tables
wanted to leave early for either study, the movies, favorite television
shows or socializing with their friends.  And the kitchen staff,
especially the male cooks, also wanted to finish work early.

It seemed that once they had time to adjust to it everyone wanted the
early hour except the more vocal residents.  Senora Jimenez growled in
her delightful self-deprecating way: "In Colombia we often finished
lunch at five-thirty!  This is uncivilized."  People who had traveled
to the Continent reported that in the good restaurants their evening
meals were often served at nine or ten, or even, at places like
Horchers in Madrid, at eleven.  Most men did not seem to mind about the
early hour, but their wives complained so constantly that Dr.  Zorn had
to carry their protests to Krenek: "Ken, can't we do something about
the dining hour?"

"Andy, I give you my word, five-thirty is the most workable
compromise-' "But some of the women-'

"Andy, have you ever watched the lineup for dinner?  Let's go down
this afternoon and see what's happening."  And Zorn thought he meant he
should be there at five-thirty, but Krenek corrected him: "I mean at a
quarter to five, forty-five minutes early."  When they got there at
that hour they watched unobtrusively and Andy saw that some of the
older couples were already lining up for their evening meal, waiting in
chairs nearby so as to be first in line.  At five some were actually in
the dining room, staking out desired tables near the salad bar, and at
a quarter past five the early birds were threading their way along the
salad bar and picking off large helpings of favorite dishes, such as
spiced apple squares and Spanish chickpeas marinated in a mild garlic
sauce.  By five-thirty when the doors officially opened, some of the
popular salad dishes were already gone.

Back in Andy's office, Krenek awakened him to the realities of food
service at the Palms or any other retirement center: "The most
important moment in the day for these older people is their evening
meal.  Sex is a thing of the past.  They don't go out to the movies
very often.  The men don't go to ball games.  Dinner is the climax of
the day.  I'm sure that if we served our evening meal at four-thirty,
the eager beavers would be in line at a quarter to four, and the
gate-crashers would have emptied the best salad dishes by four."

"I can't believe that."

This afternoon you told me you couldn't believe that our people were
starting their evening sit-downs at five o'clock.  You saw them."

"Isn't there anything we can do to stop the complaints?"

"Andy, you didn't grow up in the country.  One thing you learn out
there, early and painfully, is never agitate a hornet's nest.  You can
walk by and not touch it, no strain, no pain.  But if you poke a stick
at it, all hell breaks loose.  If you open this up for public
discussion, you'll age ten years before your time."

"Are we powerless?"

"Yes.  A compromise has been agreed on.  It works.  Not perfectly, but
it works.  So, please, no jabs at the hornet's nest," and Zorn promised
to desist from any further discussion on the matter.

It was by accident that he discovered another aspect of Krenek's second
perpetual headache.  One day as he passed his assistant's office door
he heard loud voices.  A woman was demanding: "Why can't it be fixed?"
and Krenek was attempting to calm her while a man was saying

angrily: "If you'd bought a good one in the first place, you'd have
saved money."  They were so vociferous that he waited for them to leave
before popping into Krenek's office and asking: "Ken?  What's the
problem?"  Ken answered sheepishly: "It was my fault to begin with, and
everything I've done to correct it only makes it worse and makes me
look more foolish.  You heard them."

"Cue me in."

"I'm a health nut, as you know.  Most of my proposals have been warmly
accepted.  People appreciate simpler food, well prepared, lots of
greens and low cholesterol.  Well, I decided that for dessert we should
knock off the ice cream overloaded with butterfat.  Instead, we'd serve
yogurt, healthiest sweet dessert in the world.  We tried a small sample
purchased from a public dairy, and the residents went crazy over it,
said it was the best they'd ever had.  But so many wanted it that I
thought we couldn't afford to go on buying the prepared product.  So I
had the bright idea of buying our own yogurt machine and the raw
products that go into this excellent dessert."

"What happened?"

"It worked perfectly, a smash success, and now everyone wants yogurt at
the end of the meal."

"Why the fracas just now?"

"Horrible miscalculation.  The machine we had was meant to service ten,
fifteen people.  We had to serve more than a hundred and fifty.  So it
broke down.  We had it fixed.  It broke down again.  We bought a new
machine.  It breaks down."

"What do you mean, "It breaks down"?  Do the parts break?"

"No, the system.  Some nights it makes delicious, creamy yogurt.  The
next night it turns out sweetened ice chips.  The following night it
doesn't freeze, just sweet milk at room temperature.  And the next
night it doesn't turn on at all."

That night Zorn walked through the dining room stopping at various
tables to ask about the food, and the majority of the diners said:
"Firstrate.  But there was no yogurt tonight."  The complaint was so
universal that the doctor returned to Krenek's office and announced:

"Ken, I'm taking over the yogurt machine.  This thing can be licked,"
and he took down the phone number of the distributor.

The expert Allied Yogurt sent out was a Mr.  Richardson, sixty years
old and a veteran of the dairy business: "I've been making ice cream
for

most of my life.  Yogurt is nothing but a modern variation, and you
have the best machine in the business.  A twist here, a twist there,
and you get perfect yogurt, every time."

He was far too optimistic.  His adjustments mended the machine for two
nights and the diners applauded, but on the third night it produced
shaved ice with a smear of flavoring, and on the fifth night it stopped
altogether.

When Mr.  Richardson returned to fix the machine by replacing certain
parts, it worked superbly-for half of the diners, those who beat the
opening gong.  The other half, who had respected the posted dining
hours, got no yogurt, not even shaved ice, and the complaints grew.

Zorn would not admit defeat.  He tried another machine with deplorable
results, then tried a dairy that sold him a low-fat, non cholesterol
ice cream, which the diners refused to eat.  His next proposal to the
committees of protest was ingenious: "I've found a dairy that will
provide us, within our budget, a real ice cream for those who can
handle the butterfat, and an excellent real yogurt, not frozen."  This
worked for a while, a three-tier system: early birds got the good
frozen yogurt; latecomers who were not dieting, the real ice cream;

and those who were, real yogurt.

Still Zorn was not satisfied.  One day, when a delivery man from the
dairy said: "We make a wonderful sherbet.  Costs less than ice cream.

Real fruit juices.  Low sugar.  No butterfat at all," Zorn saw this as
a solution to his problems and added the sherbet to his nightly menu.
Of course, the machine making frozen yogurt continued to break down two
or three nights a week, but the ice cream and sherbet were always
available, and now when he walked through the dining room to chat with
the residents, far more than half said: "Very good meal.  And the
sherbet at the end was quite acceptable.  We would have preferred
frozen yogurt, but the girl said the machine was on the blink again."

When a kind of truce had been achieved so that the residents no longer
accused Ken Krenek of gross ineptitude, Zorn told his assistant:

"Fair deal, Ken.  You handle the squawks about parking, I'll protect
you on the yogurt front."

To ensure that his eighty-seven retirement and health centers
remained up-to-date, John Taggart employed a team of four traveling
agents, experts in general medical care, and expected them to keep him
and his organization apprised of new developments in the field.  They
were especially commissioned to inform Taggart of any new men or women
who might be employed to strengthen any one of the Taggart centers that
could profit from the infusion of new blood and fresh ideas.

The traveler responsible for much of the eastern seaboard, one
Wilmerding, while tracking down an unlikely rumor in Georgia, came upon
a phenomenon that he reported immediately to Chicago:

On several recent trips through the Carolinas and Georgia I've heard
reports about a physical therapist and his wife who are performing
miracles in the rehabilitation field.  He seems to be able to get
paraplegics, stroke victims and people with damaged limbs back to full
or gratifying re control of their muscular systems.  And he is also
exceptional in his ability to affect his patients psychologically. He's
a long, lanky Georgia cracker who lives in a small town with his wife,
a short dumpy woman, who is already a registered nurse.  When seen
standing close together they look like the figure 10.

His name is 100% bourbon, Bedford Yancey, hers is Ella, and he reminds
me of a man my father told me about who played a major role in baseball
back in the 1920s and '30s.  That wizard at healing cranky joints,
stiff throwing arms and faulty knees was called Bonesetter Reese, and
all the big-league teams sent their damaged ball players out to this
little town in Ohio for the Bonesetter to work on them.  He effected
miraculous cures, extended the working lives of pitchers and was
especially skilled when a bone and its attached muscle were both
involved.

Bedford Yancey could be a lineal descendant of Bonesetter Reese, and
regional athletic teams are already using hisser 8 3 vices.  But he is
equally proficient with ordinary hospital cases, his rough-and-ready
country style of treating his patients being highly acceptable to the
practical-minded Georgians.

I've suggested before, Mr.  Taggart, that our establishment in Tampa,
the Palms, could profit from installing and featuring a first-class
rehabilitation room, a kind of super-sized gymnasium with
state-of-the-art physical therapy machines.  They do not come cheap,
and I'm enclosing estimates from three companies for a complete system.
I recommend strongly that you send either Ken Krenek or our new man,
Andy Zorn, up to Vidalia, Georgia-that's halfway between Macon and
Augusta-to investigate Yancey and his wife and to hire them now, if we
can get them at a reasonable salary, and encourage them to make the
Palms a rehabilitation center for the west coast of Florida at a cost
we can monitor.

When this communication reached Taggart's desk, he immediately
telephoned Wilmerding and talked with him for twenty productive
minutes, after which he endorsed in his own handwriting the man's
report: "Zorn to proceed to Georgia ASAP.  and if the two Yanceys are
as good as herein reported, hire immediately.  If they join us,
Foxworth and Krenek authorized to set up rehabilitation-area
ground-floor Health, state-of-the-art but lowest bidder.  John
Taggart."

When Andy received these instructions he went immediately to his sedan
and scooted up the good Florida highways to the Georgia border, from
where he had a clean run into Vidalia.  After asking a few questions he
learned that the well-known muscle expert Bedford Yancey lived not in
Vidalia itself but in a little rural town to the north on Route 297.

There he located the Yancey farm, with a somewhat run-down house
standing in front of a barn that had obviously been mended and
refurbished.  In the kitchen of the house he found Ella Yancey, a short
roundish woman who took him directly to the barn, where her husband was
working on a patient.  The bone setter was about six feet two inches
tall, thin as a willow wand and marked with a tousled head of red hair.
He was busy at the task of rotating and kneading the left arm of a
young man who looked to be a farm lad but who was a pitching hopeful of
the St.  Louis Cardinals, whose team trained in the area.

Hesitant to interrupt Yancey's work, Zorn approached him only when
Yancey beckoned him over.  Introducing himself, Zorn asked:

"Do you remember a Mr.  Wilmerding from Chicago who talked with you a
couple of times this year?"

"Couldn't forget him," Yancey said, not missing a stroke as his big
hands massaged the ball player's muscle.

"Quite a talker."

"He sent me to see you."

"About what he mentioned last time?"

"Yes.  You ready to talk?"

"Are you for real?  This ain't smoke rings?"

"I brought many photographs to show you.  The most attractive offer
you'll ever get."

Still keeping his powerful thumbs pressing on the pitcher's muscles,
Yancey nodded his head in the direction of the farmhouse and said:

Talk to Ella first.  On some things she's brighter than me," and Zorn
was dispatched back to the kitchen.

There he said directly: "Mrs.  Yancey, my name's Dr.  Andy Zorn.  I'm
up from Florida to talk about offering you and your husband important
jobs in the health field."

"Doin' what?"

The things he's already doing, but on a more permanent basis.  They
tell me you're one of the best nurses in Georgia-in rehabilitation,
that is-and you'd have a first-class facility to work in and wonderful
people to work on."

"What kind of people?"  she asked cautiously, and he showed her a
photograph that caught the entire Palms complex.

"You'd be in this fine building."

Studying the imposing structure, she asked suspiciously: "You own
this?"

"My company does."

"Are you in bankruptcy?  Looking for help from us?"

He laughed: "Mrs.  Yancey-' "Call me Ella."

"My company owns eighty-seven of these health centers.  This is one of
our best."

"From what I hear on television it's the big companies that slide into
bankruptcy.  We got our own troubles here in Vidalia, don't need to go
lookin' for others."  But she did study the additional photographs of

what she and her husband would find at the Palms, and gave special
attention to the brochure that listed the Taggart holdings across the
country.

"Why would you concentrate on me and Bedford for this one in
Florida?"

"Because that's where I work.  I'm the manager and I need a couple just
like you to build our rehab center."

"considering' husband and wife," she said, "I'd have to agree that
we're one of the best, at least in this part of Georgia," but she
turned back to that first photograph of the Palms and studied it from
various angles.

"You promise that this is already built?  It's not what they call "an
artist's rendition"?"

"It's there.  Look at the autos lined up."

"He can draw them, too, better than real."

Now Bedford came in from the barn, bringing with him the baseball
pitcher whom he had been treating, and as the athlete worked his left
arm back and forth, the four shared cups of strong country coffee,
slabs of greasy bacon and excellent thin pancakes with jet-black
sorghum molasses.  Andy was astonished at how quickly the other three
made the breakfast disappear, and the ball player, noticing his
reaction, said: "When you work out most of the morning, or massage the
way Bedford does, you need something' solid to help you along, and the
good thing about black strap molasses is that you can almost feel the
vitamins goin' to work through your veins."  He said his arm felt
wonderful, but he did eat with his right hand to avoid putting even
slight stress on the damaged left.

After Ella had cleared the table, she spread the photographs before her
husband and the ball player: "I was teasing Dr.  Zorn that these were
just artist's renderings, but he assures me they're for real," and they
discussed with frankness the pros and cons of moving away from the
lovely freedom of Bedford's barn and her poorly paid job in the local
hospital.  The ball player said: "It's human nature to test yourself in
the big leagues.  And you two are the best there is.  You owe it to
yourselves to give it a try."

Finally Bedford spoke in a reserved, cautious voice that echoed rural
simplicity: "Seems like if they mean this, Ella, we better pile into
our pickup and drive down to see the folks involved-and the setup of
the

buildings."  But before this could be discussed further, another
patient appeared-a girl of fourteen who had broken her right arm by
falling off a pyramid during cheerleading practice.  Her arm had to be
brought back to full use or she would miss her entire freshman year on
the squad, a tragedy she could not face.

Rather ungainly but just on the verge of being beautiful, she seemed to
have the potential for becoming a first-class cheerleader insofar as
spirit, liveliness and charm were concerned.  If cheerleading was now
and in the foreseeable future the biggest thing in her life, she
deserved the best that the talented bone setter could provide.

Andy was astonished and pleased to see how Bedford, this tall, gawky
man with the magic hands, was able to convert himself into an
eighteen-year-old to bring himself down to near her level.  He spoke
differently, he hunched himself up to become more nearly her size and
he adopted her word patterns and concerns.

"He adapts exactly the way I did with my patients," Andy said to
himself.

"Good sign.  He'd be wonderful with our old people," and he smiled as
Bedford led the girl to his gymnasium in the barn.

When her treatment ended, with her recovering some flexibility in her
right arm, Bedford returned to the kitchen, studied his schedule for
the days ahead, asked Ella to telephone the people scheduled to meet
with him the next three days, and advised her to rearrange her
meetings, too.  When she asked why, he said: "We're headin' down to
explore this Palms affair.  If it's as good as he says, maybe we'll
catch ourselves a better life."

The Yanceys had planned to drive south in their own pickup, but Andy
proposed that they ride down with him and fly back to one of the
airports convenient to Vidalia, from where they would find their way
back home.

"I'll pay the airfare and your cost home from the airport," he
promised, and this plan was adopted.

It was a rewarding choice, because they calculated the distance to
Tampa to be about three hundred miles, and since each of them was an
experienced driver, they could make the trip without stopping, except
for sandwiches.  During the trip Zorn had an opportunity to talk
intimately with the Yanceys, and the more they said, the more convinced
he became that they were a rare couple, lacking in polish perhaps, but
trained at excellent schools and full of rural wisdom.

They were devoted to the health field, had a unique understanding of
what

could be achieved, and a lively interest in making their own unique
contribution.

By the time they reached the northern outskirts of Tampa, Zorn had
decided that if the two Georgians found that they could operate
constructively at the Palms, and if he judged that they would fit in
with elderly patients, he would offer them a job, tell Miss Foxworth
and Krenek to convert a big room in Health into a gymnasium, and launch
a vigorous program to let west Florida know that a world-class
rehabilitation program was soon to be available.

They reached Tampa by midafternoon, and Andy turned right off the major
highway and drove them slowly down the splendid avenue of palms and
Brazilian peppers to the spot at which the medieval gate, the
protective walls and part of the big building were visible.

"That's a home to be proud of, Mrs.  Yancey.  The health-services wing,
where you'd work, Bedford, is over to the left."

Allowing the Georgians time to absorb first impressions, he then drove
slowly around the oval till he reached the entrance to Health.

There he parked his sedan in the director's zone and took the Yanceys
inside, leading them directly to the big room where modest efforts at
rehabilitation were under way with an enthusiastic but inadequately
trained nurse.

She was working with an eighty-one-year-old woman from Assisted Living
who'd had a total hip replacement but was making little progress in
recovering strength or control in her left leg.  For some minutes
Bedford watched the out-of-date exercises the nurse was encouraging her
patient to perform, and they were so inappropriate that Yancey asked
both Andy and the nurse politely: "Could I show her a trick we've used
with some success in Georgia?"  He stepped before the elderly woman and
underwent an almost miraculous transformation.

He bent down so that he was about her size.  The big hands that had
thumped and banged the baseball pitcher became soft, gentle agencies of
healing, and his words were those of consolation, one mature person to
another.

"Ma'am," he almost whispered, "I've seen you before, nigh a hundred
times, and usually not in as good condition as you are today.  They all
recovered use of their leg and so will you.  What you must do .. ." and
in the gentlest manner-of touch, smile, voice, hands-he exercised her
damaged leg, twisting it into contortions she would not have believed
possible.  When it was fully relaxed, he suddenly grasped her by both
hands, gently raised her to a walking position and pulled her along in
a kind of awkward dance, with him backing up and smiling, she coming
slowly forward on a leg she had been afraid she might never again use. 
At the conclusion of their little dance, her pale face flushed with
excitement, he caught her in his powerful arms and replaced her in her
chair.

Zorn stood silent.  He had now seen Bedford Yancey, this big redheaded
Georgian, in three different roles: a brawny adult knocking a
professional athlete about, an empathic friend of a teenager cherishing
a dream, and the inspiring companion to an old woman fearful of being
permanently crippled.  In Yancey he saw the kind of healer he would
himself like to be.  A few minutes later as the trio surveyed the
future rehab gymnasium, Andy Zorn hired Bedford Yancey and his wife,
giving them only one commission: "I want you to make this place
first-class."

At that moment Andy could not have foreseen that the fruitful
consequences of his act would turn out to be considerable, for when the
Yanceys moved down from Vidalia and took control of the rehab center,
they kept in contact with some of the professional athletes Bedford had
served in his barn.  When the men appeared in Florida, and occasionally
one of the women tennis players, everyone in both the Palms and the
surrounding retirement areas as far north as Tarpon Springs and south
to Sarasota heard about it, and elderly men who were sports fanatics
began making pilgrimages to see in the flesh great quarterbacks,
outfielders and basketball centers.

Incredible as it seemed to Zorn, a few ultra-dedicated sportsmen would
try to rent a room in Assisted Living so as to be on hand when some
great star was in attendance.  Zorn did not allow this but he did
encourage a more sensible reaction.  Men who had enjoyed watching
Yancey work with the athletes reported to their social circles along
the West Coast: That Palms in Tampa is a top-class operation with a
genius in control of the rehab.  If I ever have to leave home for
something serious, try to get me into the Palms."  This enthusiastic
endorsement did not fill all the vacancies in Assisted, but enough
sports enthusiasts took beds to reduce the deficit to almost acceptable
levels.  In a tantalizing way it seemed that solvency would be achieved
in one more month, but it didn't happen.  However, Miss Foxworth did
detect one reassuring omen: "When they come in to pay their rental in
Assisted three say they enjoyed their contacts with Bedford Yancey, but
nine say: That nurse in charge of the gymnasium, the Georgia woman
Ella, she has curing hands."  When that vote of confidence circulated
it brought in even more outside patients who required specialized
rehabilitation for their broken hips, mastectomies and sports
injuries.

The Palms of Tampa was becoming an important and widely known health
center.

Once Zorn found a partial solution to the vacancies in Assisted, his
mind had time to wander freely to other problems, and one day he
realized that slowly, subtly and almost subversively he was being drawn
back toward the medical profession.  He had been meticulous in
informing the residents that he was not licensed to practice in
Florida, but he could not prevent them from asking him about their
health problems.  If an illness was serious, he immediately referred
the resident to Dr.  Farquhar, who was authorized to give advice and
write prescriptions.

So, when Laura Oliphant, the onetime headmistress of an elite school
for girls, came to Zorn with one of the most terrifying problems a
woman could face, he had to listen, especially when she said, her hands
trembling and her eyes looking frantic: "I have no one to turn to."

"Regarding what?"

"I've been diagnosed, all the tests are pretty conclusive-I have a
cancer in my left breast.  And they tell me so many different things
I'm at my wit's end, totally confused," and her hands trembled.

Zorn was saddened to see this woman who had seemed so strong and
self-reliant when they had first met now reduced to a pitiful,
childlike state.  Determined not to meddle in medical matters, he said
as he comforted her: "Now, Ms.  Oliphant, you must seek professional
advice.  You know I'm not licensed to practice medicine.  I can't-'
"I'm seeking your advice as a trusted friend.  You understand these
things, I don't."  She lowered her head and began weeping, which he
wisely did not try to restrain-he knew she needed the release.  After

some moments of tearfulness she cleared her throat resolutely, sat
upright and said matter-of-factly: "Thirteen years ago I had a radical
mastectomy on my right breast.  Complete removal, and after that,
radiation to track down any stray cancerous cells-six months'
treatment."

"And you fully recovered?"  She nodded.  Then to protect himself he
called for Nurse Varney to join the conversation so that she could
testify later that he had not practiced medicine: "Ms.  Oliphant tells
me that thirteen years ago she had a radical mastectomy of her right
breast.  Now they tell her, and tests confirm it, she has a cancerous
lump in her left breast.  And she's asking us what she should do."

"Are you satisfied the tests are accurate?"  Nora asked and Ms.

Oliphant said: "Yes, I'm satisfied there's something in there."

"What do your doctors recommend?"

"That's the problem.  I get a different answer from each doctor I
see.

I've had six of them, and they refuse to give me any clear answers.
Each one has his own theory, but there's no consensus."

"Six doctors?"  Nora asked.

"Yes, six.  Dr.  Farquhar told me: "If you had a major cancer thirteen
years ago, and now you have a lump in your other breast, it has to be
taken seriously.  Go immediately to Dr.  Swain, he'll tell you how to
proceed."  ' "And did you go?"

"Yes.  And he told me: "We have two options.  Another radical like
before, or there's this new theory-it's a lot more than just a theory,
it works.  A lumpectomy.  We avoid massive surgery.  Go in with a very
small probe, excise the cancerous lump, and move on from there.  But
first we must be sure of what the situation is."  So he sent me to a
radiologist who provided an X ray of the lump.  It looked malignant,
but to be sure they all wanted me to go to surgery and have a tiny
biopsy, a probe, and it proved positive.  I had the cancer, just like
before but smaller.  The doctors agreed that although I had a cancer,
we'd detected it in time.  A lumpectomy was practical, but a mastectomy
might be safer-more certain to get all of the cancer.  To make that
decision I had to consult another doctor, a surgeon who specialized in
these matters, and he said: "Fifty-fifty," and he outlined everything I
already knew, but when I asked him what I could do, he refused to say.
Told me only I could choose among the alternatives."

"Where does it stand now?"  Zorn asked gently, and she said: They
all agree that there are several options among which to choose.  Total
job as before or a much simpler lumpectomy.  Then follow-up radiation
or chemotherapy.  I'll lose my hair with chemo, but that's one of the
options.  After that, a concentrated treatment with the new wonder drug
Tamoxifen, which they say performs wonders in neutralizing
breast-cancer remnants.  It sounds promising but they tell me there are
also negative aspects.  I'm confused."

When both Zorn and Nora said that it sounded as if she'd done her
homework, she grimaced and said: Too well.  Because no one would advise
me what was best, I doubled back to the two men who had saved my life
thirteen years ago.  I called each on the phone and what do you think?
My surgeon who did the great job on my right breast said:

"Recent advances have convinced me that we cut too much.

Nowadays I'm doing lumpectomies followed by lots of radiation to kill
off the stragglers."  And my radiologist said: "Laura, I no longer do
that heavy radiation bit.  What do I recommend?  Full mastectomy,
followed by chemotherapy."  ' She spread her hands beseechingly to the
two medical professionals and asked: "So what does a woman do?"  and
Zorn said: To help women just like you, hundreds of them left adrift in
American medicine with no radar or old-fashioned ship's pilot, a new
specialty has appeared on the scene.  The oncologist."

"What in the world does an oncologist do?"

"He's the referee.  Studies all the reports on your case, listens to
the conflicting opinions, weighs the evidence and gives you his
judgment as to what's best."

"Where do I find one?"

"I'll ask Dr.  Farquhar to make a referral.  There must be several in
the area," and when, as the manager of the Palms and not as a doctor,
Andy consulted with his house medical adviser, Farquhar was able to
recommend three trustworthy and knowledgeable oncologists.

When Andy asked: "Which one would you use if it were your wife?"

the answer came loud and clear: "Dr.  Sam Bailey.  Practices here in
Tampa, none better."

When the time came for Laura Oliphant, seventy-six years old, to
consult with the new man, she insisted that Dr.  Zorn accompany her.

Dr.  Bailey, a man in his mid-forties, was not pleased with the
prospect

of counseling a patient when another doctor was present, but Zorn
explained that he was there simply as director of the Palms and thus a
kind of custodian of the woman.

"No husband?"  Bailey asked, and when Laura said: "No," he asked:

"No trusted lawyer?  No grandchildren?  Well, you really are alone.
Stay with us, Zorn."

And then began one of the travesties of American medicine, a forgivable
one that does little harm and some good.  For a fee of four hundred and
fifty dollars, Dr.  Bailey simply told Ms.  Oliphant what she already
knew, but he did it in such a thorough, skillfully organized manner
that she could understand each step in this intricate and frustrating
battle with breast cancer.  Even Zorn was amazed at the complexity and
the routine guesswork facing any woman with the affliction, no matter
how intelligent she might be.

Dr.  Bailey sat in a straight-backed chair with no desk in front of
him, in an office that resembled the living room of a genteel,
middleclass suburban family.  Ms.  Oliphant was given a comfortable
chair with armrests and Zorn was allowed to bring in a chair from the
waiting room.  The room was subtly lighted, hardly enough for reading,
and decorated with three Winslow Homer prints of marin escapes  His
consultation consisted of a thorough lecture on breast cancer in
American females.

"It is one of the disgraces of American medicine," he began, 'that
research in this field has been left primarily to men, and they've
treated the subject almost with nonchalance.  Very little real work has
been done, in the opinion of many, with the result that how you are
treated, Ms.  Oliphant, or women like you, depends largely on where you
live when you consult your surgeon.  In the conservative Mississippi
River Valley and to the west it's radical mastectomy and cutting out
every lymph node-what you had some years ago.  In the more
sophisticated Northeast it's now mostly lumpectomies.  In the South,
except for Florida and its geriatric specialists, it can be heavy
surgery on the principle that if the patient isn't well cut up she's
not getting her money's worth.  Same way with radiation, very heavy in
the West, not so heavy down here.  Some favor chemotherapy as the
followup, especially in cases of a recurrence.  And with Tamoxifen, it
depends on which doctor you go to among the six on the same street."

He apologized for this confusion, pointing out that much of medicine
was influenced by the region in which the doctor had been reared and
educated, and said: "But the variety of recommended treatments for
breast cancer excels all other diseases."  He coughed, took a drink of
water and asked: "So which of these seemingly endless variables is
best?  Let me explain the immutable fact, the one that overrides all
else.  If a young woman is diagnosed as having breast cancer and
refuses to do anything about it, rejects her doctor's advice,
regardless of which part of the nation he practices in, she dies at a
young age.  She dies.  In her stubbornness she dies.  I will admit no
debate on that salient point because I help to bury them, year after
year.

"The same rule governs your case.  If you refuse to take any steps, you
will die six, eight, ten years prematurely.  You have the option to do
nothing, but you must be aware of how you're endangering yourself."

Allowing this mournful truth to sink in, he changed his tone of voice
to a much brighter one: "So what are the avenues of escape?"  and in a
brilliant summary of current knowledge he reviewed the pluses and
minuses of each of the acceptable procedures, making the evidence so
forthright and unequivocal that any attentive listener could have
understood: "It seems to have been proved a hundred times over that
tracking down cancer cells that may have escaped into the lymph nodes
and destroying them there, either by surgery, chemotherapy or
radiation, saves lives.  The terrible word in cancer therapy is
metastasizing.  If the cells break loose and are left free to attack
other organs in the body, and they have time to take root there and
multiply, all hope is lost.  That's when you hear the awful words:
"They cut him open, looked around and sewed him right up again.  Three
months to live."  ' He smiled at Ms.  Oliphant and said reassuringly:
"I used the pronoun he because that sentence is used most often about
men.

They allow a cancer of the prostate to spread its cells to the liver
and the spleen and the lower stomach, and by the time we get to the
mess, nothing can be done.

"Sew him back up."  ' He told her that metastasizing in women's breast
cases was less virulent or immediately deadly because the fugitive
cells did not find so easily and rapidly an organ like the liver or the
lower bowel in which to multiply at some horrendous rate: "With you,
it's slower but in the long run just as deadly.  So what can we do to
track down and destroy those vagrant cells that become such killers?
Well, in the old days, like

thirteen years ago, we cut out not only the breast cancer but also
the places to which the wandering cell might have fled.  Tough on the
patient, as you know, but also very tough on those merciless cells."

And he proceeded with case histories in the newer treatments.  He said
that lumpectomies, if followed by rigorous radiation or chemotherapy,
were producing good results, but also had some drawbacks.  He was not
overly enthusiastic about Tamoxifen:

"Because there haven't been enough studies of possible side effects.
That it slows down the migration and even the growth of cancer cells
there can be no doubt, but at what cost we really don't know."

When it was apparent that he was concluding his lecture, Ms.  Oliphant
said: "You make it so clear that even I can understand it.  Don't you
agree, Dr.  Zorn?"  When he nodded, she said to the two doctors:

"So what course am I to take?  I want to live as long as possible,
because there is so much left to be done."

Dr.  Bailey then gave her the most dismaying news: "It is not in my
capacity or knowledge to tell you specifically what to do."

"Damn it, who can?"  she almost screamed.

"No one.  We're in a dark alley of human experience where the rules of
procedure are not yet known, so I cannot prescribe."

"Who can?"

"Only you, relying on such counsel as your dearest friends and your
doctors can give."

"That's why I came to you, Dr.  Bailey."

"And I can give you these guidelines to help you decide.  If you do
nothing, as I said at the beginning, you are doomed.  If you take any
one of the defensive steps I've outlined, your chances are markedly
improved.  And if you elect all three, I can tell you without
hesitation that you will enjoy a ninety-seven percent chance of
survival till something else finishes you off.  If you're sensible,
your chances are extremely good."

"You mentioned "defensive steps" but you didn't specify them."

"Mastectomy or lumpectomy.  Radiation or chemotherapy.

Tamoxifen."

"And doing only two?"

The odds in your favor diminish."  When he saw her blanch he quickly
added: "But not catastrophically.  Look at your case.  Years ago you
had only two choices, yet you lived a good life for many years."

"Are you married, Dr.  Bailey?"

"I am."

"If this were your wife consulting you, what would you advise?"

He reflected, then said: "I'm constantly asked that question, Ms.

Oliphant.  It's sensible and inevitable.  And I know exactly what I'd
do, I'd listen carefully to everything I've said, and then I'd consult
the three best doctors I knew, and maybe my lawyer and accountant, and
one night at four in the morning I'd sit bolt upright in bed and
shout:

"Rachel, this is what we're going to do, if you're brave enough to go
the route."  And I would pray that she'd say she was ready."

"And what would that route be?"  she asked and he had to confess:

"At this stage in my life, and with the imperfect knowledge we have, I
honestly don't know."

When he led her from his office, he said: "Now you know everything I
know.  You also have a friend in Dr.  Zorn, who seems eminently
sensible.  And you trust Dr.  Farquhar.  Make up your mind, say in
about six days, and I shall pray that you have the courage and the good
sense to adhere to whatever plan you decide upon."

When Zorn trailed behind, Bailey told him: "We all need counsel.

Don't hesitate to help her because of some legality."

But when he caught up with Laura, she looked at him with dumb despair,
tried to speak and ended in a shriek: "Damn it, damn it!  I consult the
wisest men in Tampa and they can tell me nothing.  Dear God!  Why do
you all desert us, leaving us to figure everything out for
ourselves?"

Throwing his arm about her shoulders to calm her, Zorn took her to his
car and drove her back to the only refuge she had left, her circle of
friends at the Palms.  But when they reached the fortress gate and
could see the handsome center dedicated to health and rehabilitation,
he thought not of her confusion but of his own: How strange that
because of fear of litigation medicine has fallen into this state when
notable experts like Dr.  Bailey are afraid to give simple
recommendations as to what a patient ought to do.  We shy from the
great tasks and occupy ourselves with the petty.  Wrong, wrong, but how
can we correct it?

Later in the spring when Dr.  Zorn had cause to believe that he had
the Palms on a road to ultimate solvency, he launched a campaign that
was to prove frustratingly futile.  As he wandered through the three
segments of his realm, he stopped to chat with residents, eager for
them to know that he was watching out for their interests.  He was
increasingly greeted as "Dr.  Andy' or referred to as "Our Dr.  Andy'
to whom questions of deep concern could be addressed.

He did his best to provide solutions to general problems or to help
when the appeal was from an individual who needed help in his or her
private concerns.  Thus he lengthened the hours in which books could be
taken from the library and arranged new starting hours for the films
that were shown twice a week.  He also helped a widow solve a
bewildering problem with her taxes and found extra quarters when some
couple was visited by three grandchildren instead of two.  In this way
he helped bind the residents into a closer-knit group while at the same
time helping himself understand the complexities of a retirement
center.

One afternoon when he was inspecting the savanna he passed the spot
where Judge Noble sat on the bulkhead, his fishing pole out in the
water and his congregation of birds standing like some Greek chorus
about him and the tame pelican in the water yapping for his share of
whatever fish the judge might catch that day.  And the thought came to
him like an epiphany: That good man is an adornment to this place.

He and his birds must bring untold delights to our residents, and I
must do something to show my appreciation.

Heading directly for Ken Krenek's office, he asked: "Could I scrape up
the funds to provide Judge Noble with a proper chair for his fishing?

One with a wide band of wood across the back so we could have his name
painted across it?"

"You'd have to check with Miss Foxworth to see how her petty cash
stands."  But when he discussed the matter with her she asked, as
always: "What kind of money are we talking about here?"  And he said:
"I think maybe fifty dollars would cover it, plus maybe fifteen for the
lettering."

She could not control her amazement: "Andy!  Are you out of your
mind?  There's a secondhand furniture shop down the road where you can
find a good chair for nine dollars, and I have a great do-it-yourself
lettering kit, if you provide the black paint."

She found pleasure in driving him to the secondhand shop, and on the
way she said in a conciliatory tone: "It's a great idea, Andy.  You'll
make the old judge feel like an honored guest."

They found a sturdy old chair for seven dollars and a small can of
paint for one fifty.  Back at the Palms, Zorn spent part of a morning
sanding the chair and tightening the screws, after which Miss Foxworth
did the lettering in a style as professional as she had promised.

When Zorn saw the finished chair he was enthusiastic: "It's handsomer
than I expected.  That's the chair of a real fisherman," and he and
Krenek alerted some of the residents to be ready to accompany Judge
Noble when he left Gateways that afternoon to go out for his fishing:
"Don't trail along with him.  He'd be suspicious.  But when he sees the
chair, rush out and give him the big hello!"

Then, about an hour before the judge customarily went for his fishing,
Zorn and Krenek carried the chair to the spot where the judge usually
sat on the bulkhead and placed it in position.  A score of people
watched from their balconies as the white-haired judge left Gateways
with his rod, walked down the path as birds clustered about him and
came to the chair on which a heron was perching.  There, at the feet of
the great blue, stood his name in fine blue lettering: JUDGE NOBLE.

He was deeply touched, especially when the group of residents who had
quietly followed him rushed out to surround and congratulate him.
Watching from the channel, even Rowdy the pelican seemed to be
applauding.

Two days later when the judge walked down for his fishing, the chair
was gone.  At first no one had any idea of who might have taken it, but
later a woman on the third floor said that the previous night she had
been on her balcony because she was unable to sleep and had seen two
men come from the landing at the river, creep down the path and steal
the chair.  Why had she not reported this sooner?  She said: "I'm
reporting it now, first chance I've had."

Zorn was outraged, especially since the thieves could have bought such
a chair for only a few dollars.  He went back to Miss Foxworth and
said: "I can't allow hoodlums to ruin a great idea.  Take me back

to the furniture store.  We'll get another chair.  And I'll pay you
five bucks for lettering it like last time."  As they drove back to the
Palms he explained his strategy: "This time we bind the four legs with
wire straps to sturdy poles three feet long, and we sink those feet
deep in the ground.  We'll put a flange at the bottom of each leg so
that when the earth is tamped back in, the leg can't be pulled out."

This solution worked, for when the legs were well sunk into the earth,
with the flanges securely anchored at the bottom, the chair with its
fine lettering could not be stolen, and the various people who had
helped Zorn in this adventure applauded when the chair remained in
place with its festoon of birds each afternoon.

But Zorn's triumph did not last long, because on the fifth or sixth
night the woman who could not sleep telephoned the main desk: The same
people, I think it must have been, brought saws, and cut off part of
the legs and carried the chair away."

Zorn declared war: "Ken, phone around and find a place where I can get
four steel pillars.  We'll sink them in concrete four feet down, and
build us a chair seat between the parts that are above ground."

That would work, but we can't do it from petty cash."

"I'll pay for it," and under his direction a very solid engineering job
was done, leaving no wooden parts that could be sawed away because the
seat itself was made of the steel seat of an abandoned tractor, and now
the judge had a seemingly indestructible chair.  But not quite, because
some nights later the same watchdog called again: They're beating it to
death with hammers!"  Running out with a flashlight Andy saw that the
woman had reported correctly.  The tractor seat had not been stolen but
simply smashed to pieces as it remained bolted to the steel pillars.

Back in his office at four in the morning with hot cocoa that Krenek
had made, Andy asked in deep frustration: "Ken, what's going on out
there?  If the chair could be used, then I could understand stealing
it, or even stealing half a chair that might be added to, but simply to
destroy a chair for no good reason, that by damn I cannot fathom."

"Andy, you're a good, kind man, but you really are naive.  Time to face
facts.  In a top-quality place like this, there are people all around
us who hate our guts.  They tell one another: "The place is crowded
with millionaires, let's wreck it."  We've had a lot of damage around
here that I haven't bothered you with."

"But why do they do it?"

"Why did that quiet young man on Long Island murder eleven young women?
Why did the guy in Sausalito murder his wife and four kids?  Why do
they paint ugly words over our sign, no matter how many times we clean
it up?  I'll tell you why.  Because this world contains an irreducible
minority of sick sons of bitches, and sooner or later one of them is
going to impinge on your life, and mine.  The chair destroyers? They're
your initiation to the breed, and there's lots more like them lurking
out there."

"You have a harsh view of the human race, Ken," and the older man
replied: "More of their horse manure has piled up in my front yard.

You're just beginning to get your share."

And four mornings later Zorn received an enormous dump load of the
stuff right in his face when he left his apartment in Gateways and
walked down to his office to what sounded like a buzz saw operating
close to the oval.  He ran out to investigate and found a team of men
in the process of cutting flush to the earth the handsome Brazilian
pepper trees whose red berries formed such a lovely counterpart to the
great palm trees along the entry drive.  If they were cut down, half
the beauty of the place would be lost.

"Hey!  Hey!"  he shouted, running up to the men who could not hear him
because of the deafening whine of their saws.

"Stop that!  Stop it now!"  And he informed the man in charge that he
was the director of the Palms and the trees were absolutely not to be
tampered with.

The foreman asked incredulously: "Hasn't anyone told you, Buster, that
these shrubs are a pest and the Florida agricultural people have passed
a law they can't be planted around a house.  They run wild and destroy
native plants."

"But these aren't running wild.  Look, they're in a neat line.  We keep
the grass trimmed around them.  It's like a park."

"It's the seeds, mister.  Millions of them.  Look at those birds.  They
eat the berries, the seeds pass right through the intestines and out
onto land that hasn't been contaminated yet.  Look at that wilderness
out there on your doorstep.  It's lousy with Brazilian pepper bushes,"
and when Andy looked, he did indeed see a wealth of the green-and-red
bushes.

"I forbid you to cut another shrub till I get confirmation from your
head office that ours have to go.  Give me the number to call."

The man laughed: "Mister, I am the head office.  It's the law."

"But I demand confirmation."

The foreman pointed to one of his men: "Claude's my assistant.  Give
him confirmation, Claude," and the new man said in a persuasive manner:
"Mister, what he says is right.  The law is that these pests that
endanger Florida agriculture have got to go."

Zorn insisted that they stop until he could obtain additional
verification from someone, but the foreman warned him: "I have orders
to remove these bushes, and if you try to stop me you'll be fighting
the entire government of Tampa, so, please, mister, stand back and let
me get on with my job."

"Krenek!"  Andy shouted.

"Come out here and help me!"  But when the administrator appeared he
brought bad news: They warned me last week they'd be here to remove the
Brazilians.  I didn't want to bother you with the details.  It's all
legal because they're a menace."

Zorn felt defeated.  Since the day of his arrival in January, whenever
he had driven into or out of the Palms he had felt that the glorious
avenue of Washingtonias and Brazilians was one of the major assets of
the center, and to think of losing the Brazilians with their bright red
berries made him sick, actually uneasy in his stomach.

"I don't want to watch this desecration," he said, turning his back on
the workmen, who resumed their cutting.  When he reached his office and
could still hear the buzzing sound of their saws, he could hardly bear
staying at his desk.  So he telephoned Ambassador St.  Pres to ask if
he would be free to wander through the savanna, and St.  Pres replied
eagerly: "Always glad to get back to my Africa!"  He soon appeared in
his safari costume.

"Better put on some rougher clothes than that, Doctor.  We're to tramp
right through the heart of it," and off they went through the light
morning mists, inland from the channel on a path that would take them
to the Emerald Pool, where St.  Pres could point out the interesting
low shrubs interspersed with medium-height palm trees and an occasional
giant palm.  But as he followed where the ambassador pointed, he saw
off to one side a glorious spread of Brazilian pepper bushes, laden
with berries that glistened in the sunlight.  They were survivors from
the Christmas season, and the display they made-an impenetrable hedge
of beauty-caused Zorn's heart to leap.

"Mr.  Ambassador!  Did you know they're right now cutting down the

magnificent line of these bushes that line our entranceway?

Government orders."

"I heard they'd declared the Brazilians a menace to be eradicated.

But ours on the avenue?  That's incredible."

"What's to happen to our earth, sir?  Everywhere I read about or see on
television they're destroying wildlife.  I grew up in a city, I
appreciate what we have out here, but nobody else seems to give a
damn."  He studied the majestic display of the Brazilians, a wall of
tangled color, green and red, and again felt nausea, but the ambassador
was back in his beloved Africa: "Now, Andy, you see that curious growth
of high, matted grass, impenetrable in that direction?  That's the kind
of hiding place we'd be likely to find lions.  That open veldt over
there with the low trees, that's elephant country.  And the sort of
meadowland in between, little growth but grass, that's for the
antelopes."

Since the savanna stretched some miles to the south and grew ever more
crowded with vegetation, including good-sized trees, the two men had
many areas to explore, and at one point when they were deep within the
growth, Zorn cried: "Can you imagine?  Only a few miles from Tampa, and
we have this wonderland!"  St.  Pres said: "It's the duty of you
younger men, Andy, to ensure that places like this remain.  My
generation didn't do a very good job, but there are places like this
hiding here and there.  Africa!  Africa!"  and he reveled in the
similarity:

"And so close to where I sleep!  It's truly miraculous!"  and he danced
a little jig, as if he were again in the veldt of Botswana.

They continued their game of safari among the wild beasts for about an
hour before St.  Pres as the older explorer said: "About time for me to
head back.  But let's cut right through the wildest part of all," and
soon they were ducking low to penetrate almost impassable natural
barriers of intermeshed lianas, bushes and tangled branches.  Zorn's
face was scratched by thorny twigs and his trousers were snagged by
branches as the men slowly forced their way through.  At last they
found themselves less than fifty yards from the Palms.

The building looks inviting, doesn't it?"  St.  Pres asked, but Zorn
could see only the destroyed remains of the fishing chair and the empty
gash where his pepper bushes had been.

By mid-April Dr.  Zorn felt that he knew and understood most of
the residents at the Palms.  Richard St.  Pres, rigid and reserved,
could only have been an ambassador, and Senator Raborn had been
destined to be an energetic politician.  The Duchess had been a grande
dame in her middle years and Maxim Lewandowski, the tall, angular
fellow with the European accent, had clearly been a child prodigy in
the sciences, for he still retained that boyhood enthusiasm for his
field, the unraveling of the mysteries of human genetics.

But one man eluded him.  Blustery, red-haired Muley Duggan-who knew
what his first name really was?-looked like a minor New York gangster,
with no neck, big ape-like arms, loud rasping voice and shifty watery
eyes.  He was in all ways a mystery, especially his being married to
one of the most gracious ladies at the Palms, Marjorie Duggan, who
occupied a separate apartment in Assisted Living.  In contrast to his
brute strength, she must have been frail even before contracting
Alzheimer's, and one could imagine her lending a delicate grace and
dignity to a cotillion in her youth.  Where he reveled in sports,
especially professional football on television, she preferred the
broadcasts of the Metropolitan Opera.  And in their double suite in
Gateways, which they occupied before she was stricken, he had listened
to noisy country music, while on her private stereo system in the back
room she had taken enormous pleasure in playing a selection of compact
disks featuring the current opera singers like Kiri Te Kanawa, Marilyn
Home, Placido Domingo and Luciano Pavarotti in their renditions of the
great arias from the major works.  Muley began to listen to her music
and, to his own surprise, became something of an opera buff, so they
came to share a common interest.

They were such an unlikely pair that Andy started asking questions
about how they had managed to get together and remain happily so if
reports of their earlier years in the Palms could be believed.  When
Krenek was interrogated, he said: "I was bewildered when they came in
eleven years ago as two of our first residents, for she was all classic
beauty and he was a rough-and-tumble Bronx brawler.  I put it down

as a dreadful mismatch, but it quickly became evident that these
two really loved each other, were happy together, and had worked out an
arrangement that allowed him to continue to drink beer and her,
champagne.  Their secret?  I never discovered what it was, but it ought
to be patented and sold in a bottle.  A lot of couples, including some
here at the Palms, could use the elixir."

When asked about them, the headwaiter said: "Muley set a high standard
for the other men in that he was so courteous toward her.

Always holding her chair, always standing up when she returned to the
table, always deferring to her in a conversation with others, and
always jutting out his lower jaw as if he would tear anyone apart who
bothered her in any way."

"What happened when she had to be moved to Assisted Living?"

Zorn asked, and the waiter explained: "Each afternoon at five he takes
the elevator up to Assisted, helps dress his wife in a formal gown,
places her in her wheelchair and proudly brings her down to the dining
room and sits her at that table, where he usually invites someone to
join them for dinner, but I've seen that people refuse the invitation,
if they can."

That seems cruel."

"Not if you've sat with them once or twice."

"Is it that bad?"

"Worse."

"What do you mean?"

"It's so terrible-the way she behaves.  Almost every meal she'll
suddenly stop in the middle, look at him as if he was a stranger, and
snarl at him.  She doesn't know who he is, but she's convinced he's
done her wrong in some way."

"What does he do?"

"Sits there and takes it till she calms down.  Then he resumes feeding
her.  She can't do it by herself, you know."

Then what?"

"Well, she loves yogurt, but as you know, most nights the machine's
broken, and she ends the meal abusing him for having broken it."

"Do you wait on them often?"

"I enjoy it.  He's a sharp guy on sports, and I study her to see if
there's any pattern in her strange behavior."

"And your conclusion?"

"Random.  Except that she despises him for something bad she imagines
he did to her."

"Any clues as to what?"

"It changes.  Sometimes it's money, sometimes the conviction that he
mistreated a daughter she fantasizes she had.  Could be-' "Do they have
a daughter?"

"No.  I checked.  They married late, you know.  No children."

The mystery of Muley Duggan grew darker and more complex as Andy
accumulated bits of evidence about his past life, but one thing was
clear: his vulgarity was unquestionable, as the doctor observed when he
was invited by the Mallorys to accompany them on a visit to Muley's
apartment for afternoon cocktails.  Pasted onto the wall beside the wet
bar that Muley had installed at his own expense was a poster:

I'm not a fast bartender And I'm not a slow bartender You could call me
A half-fast bartender On the bar itself lay stacked copies of Sports
Illustrated, Time and National Geographic, with four ingeniously
devised puzzles that were difficult to do when sober, impossible after
a few drinks.  It was the apartment of a bachelor with a robust
appetite for games, beer and cartoons that verged on the unacceptably
offensive.  Several male residents had complained to Zorn on behalf of
their wives who had objected to a joke Muley delivered at the Mallorys'
celebration of their return to the Palms.

It had been a gala affair, with the Mallorys in good spirits, dancing a
waltz.  Muley took the microphone and said: "Last week our dear friends
Chris and Esther made a sentimental journey.  They flew back to Niagara
Falls, found the same hotel they'd stayed at on their wedding night,
got the same room with the same four-poster bed and did everything
they'd done sixty years before."

A stooge who had been coached by Muley asked in an awed voice:

"You do mean everything?"  and Muley said: "Only one difference.  On
the wedding night after they went to bed, she got up, went into the
bathroom and cried.  This time he went in and cried."

When several widows complained that this was far too vulgar for
the public recreation area, he accepted the rebuke, but continued to
tell gentler jokes that illustrated aspects of life among older people
in retirement.  Two were widely repeated: "This clergyman was invited
to the Palms to give an inspirational talk, and he told us: "Especially
as we grow older we must give thought to the hereafter," and at the
conclusion of his little sermon this woman from floor four hurried up
to him and said: "Reverend, I'm so glad you said what you did.  I think
of the hereafter almost every day of my life," and he said: "That's a
worthy habit," and she said: "I find myself entering a room, stopping
in the doorway and asking myself: "Now, what did I come hereafter?"

"' But the favorite was one that touched a lot of lives, and he told it
well, week after week as newcomers drifted in: "This woman on floor
three, you all know her, told her husband: "I am dying for a hot fudge
sundae.  Will you be a dear and run down to the corner and get me
one?

But take your pad and write down exactly what I want," and he said: "I
can remember," and she said: "Please write it down.  Vanilla ice cream,
hot fudge, nuts and whipped cream.  Do you have all of those things
written down?"  He said he had, and off he went.  He was gone longer
than usual, and when he returned he handed her a brown paper bag
containing a hot dog in a roll.

"See!"  she cried.

"You should've written it down.  You forgot the mustard!"  ' During
Zorn's first visit to Muley's apartment, he was awed by the immense
size of the place and the number of rooms standing more or less unused,
and during drinks the doctor pressured Duggan: "Every now and then we
have a request for an oversize apartment like this.  We could provide
you with a neat two-bedroom affair in the Peninsula," but Muley bluntly
rejected the suggestion: "No way.  This is Marjorie's apartment, and I
keep hoping she'll be returning here soon.  That Alzheimer's Center at
the University of Southern Florida is right at the breakthrough point
in finding a cure, and I'd want her to see the rooms as they were when
she left."

Afternoon cocktails at Muley's ended at five, for then he went
regularly to Assisted Living to dress his wife and escort her down to
dinner.  On this evening he suggested: "Dr.  Zorn, you've not gotten to
know my wife.  Join us for dinner in a few minutes," and in this casual
way Andy experienced dinner with the Muley Duggans.  He'd often

seen Marjorie in Assisted, but each time he was struck by how
beautiful she was, how extraordinarily fragile, as if her head were
made of some exquisite Chinese ceramic that allowed the veins to peek
through.  Proudly Muley walked her to their table and placed her in a
chair beside the one in which he would be sitting.  With this
arrangement he would be able to cut her food and feed her a forkful at
a time, then watch her as she slowly chewed and then took a sip from
the water glass as he lifted it to her pale lips.

"She's doing better tonight," Muley told the headwaiter whom Zorn had
interviewed, but the young man looked at Andy and shrugged his
shoulders as if to say: We'll see.  It often starts like this.

When the tediously slow meal was at midpoint, she suddenly drew back,
glared at Muley and said in a loud accusatory voice: "You did it again,
damn you.  You hid the letters my daughter sent.  You never let me have
them."  And then she began railing about how he had stolen her money
and left her destitute.  She would warn her husband about the misdeeds
of his faithless friend.  Andy found her performance so unpleasant that
he wanted to leave the table, and wished that some messenger would come
to tell him he was needed in the office, but none came.  Then, as he
reflected silently on the ungraciousness of his desire to flee one of
the great human tragedies of our time, he composed himself and
concluded that here was a mystery greater than he could resolve.  Muley
was a man in love under circumstances so strange that ordinary words
could not explain it.

When the meal ended, with Marjorie refusing the dessert, which she
suspected of having been poisoned, Zorn asked Muley: "Would it be
possible for me to join you when you take her back upstairs?"  Muley
was so appreciative of his interest that he agreed effusively, and the
three went to the elevator, ascended to Assisted and went to her room,
where Muley prepared Marjorie for bed.  As the men were leaving her
room, they looked back at this beautiful woman and Muley said with the
greatest confidence: "I live from day to day, following reports from
the team at the university, hoping that news of the breakthrough will
come."

"Do they think that a cure might be found that would reverse the
disease?  That would cure those already afflicted?"

"No," Muley said with a deep sigh.

"But they believe that what they can do is stop other people from
contracting it.  Women like Marjorie,

they're lost.  Their brains have been damaged beyond repair.  But
even so, we continue to hope-to pray for the miracle that we know will
never come."

This episode at dinner, and Muley's reaction to it-his extraordinary
patience and his love for her no matter how she behaved-made Zorn even
more curious about the mystery of this strange marriage.  His queries
led nowhere until one day when Nora was in his office checking some
filing cabinets, he asked casually: "Nurse, what do you know about the
Duggans?  They seem a curious pair-fascinating."

"Know?  I know everything."

"How?"

"I was their family nurse when they first arrived.  That was before I
got promoted to my present job.  In the evenings after dinner they
would sit on their veranda overlooking the river and tell me about the
old days."

"How did they meet?  Such a bizarrely matched couple?"

"She was a society woman, married to a gentleman, graduate of Harvard,
head of four big department stores in New England, I believe, but it
could have been upstate New York.  Muley was the owner of the trucking
company that served the stores.  With an exclusive contract, it was
like part of the company.  They told me that Muley became part of the
family, completely trusted, even went on vacation cruises with them.  I
take it the husband was a kind of fancy-dancy fellow, they had no
children and he was never well.  Before he died, they told me, he
called them together on the ship they were on at that time and told
Muley: "When I'm gone, Muley, take care of this woman.

She'll have the money, you'll have the good sense."  They laughed when
they told me that and Muley said: "I'll bet he never thought I'd take
him seriously and marry her, but I did," and he added: "I think she was
pleased to be married to a man who'd had to work.  You know, Nora, she
became an officer in both her stores and my trucking company, and she
was smarter than any of us.  That's why I'm so nice to her."  ' Zorn,
astounded that a couple like the Duggans would have confided such
secrets to Nora, asked: "Why would they have told you these things?"
and the big woman said: "Why does everyone open up to me?  Because I
listen, really listen, and I'm not afraid to tell them when they're
talking like damned fools."  Later, Zorn learned from various sources
that all Nora had said was accurate.

Now Andy had become a good friend of Muley's and from his
frequent visits to the Duggans' apartment he learned that Muley had
learned to play Marjorie's collection of operatic disks and had
mastered the trick of picking a single aria from the middle of some
disk and transferring it to a tape.  In fact, he had become so skilled
in this rather difficult maneuver-half a dozen different buttons to
push and split-second timing in handling each one-that he had succeeded
in making several almost flawless sixty-minute tapes of the music his
wife had liked most, and from them he had assembled one master tape
that played what he called the Marjorie Duggan All-Star Concert.  He
duplicated this master tape onto three fresh cassettes, and kept one in
Marjorie's old room, one by the stereo machine in her new room, and one
in safekeeping, lest the others be damaged.

Zorn, who had attended operas both as a student and as a doctor in
Chicago, knew much of the music and asked to hear what Muley had
recorded for his wife.  Muley started the tape in the apartment and
handed Andy a typewritten copy of the program: "Marjorie is very
feminine, as you've seen from those pictures I showed you of her with
her first husband.  Frilly gowns, fancy hairdos.  Well, she loved arias
in which two women singers, one with a high voice, one low, sang
together.  She thanked me a dozen times for making her this private
concert of her music, of her women singing about their joys and
sorrows."

There in the apartment overlooking the river and the channel, Zorn sat
rapt as Muley's expensive speakers poured out the rich music his wife
had loved: "She would sit here and explain what I was hearing, and in
time I came to know.  This is Madame Butterfly and her maid decorating
the house with flowers for the American's return.  He'll return, all
right, but with an American wife.  She'll commit suicide.

This next one was her favorite, from an opera called Norma about Romans
and Druids.  She loved this so much that I often called her Norma:
"Hey, Norma!  Here she comes again," and we'd listen as the two women
sang about the Roman soldier that neither of them was supposed to love.
Forbidden because they were priestesses.  But Norma died and I think
the other woman died, too.  Listen to those heavenly voices.  Marjorie
loved this recording.

"This next one is the one I grew to love best.  It's in a place called
Ceylon, again a priestess loving somebody she shouldn't.  When I
think

of Marjorie I think of these voices in the jungle-so simple, so
feminine.

"This next one, you've always known it, so did I, but I never knew what
it was.  I don't know what they call it but it's two women in a gondola
in Venice."

"Isn't it the "Barcarolle"?"

"I don't know, but I am sure about the gondola.  Listen to how those
voices blend.  Marjorie liked it, too.  This one she listened to a
great deal.  If you look on your paper, it'll give you the two names."
Reaching for his catalog, Muley read: "Beatrice and Benedict by a guy
named Berlioz."  He mangled the pronunciation but added: "Two women
talking on the night before the wedding.  Marjorie said they spoke for
all women.  This next one by a German composer sort of captured both of
us.  Marjorie explained everything to me the first time I heard it. One
of the women plays the part of a boy who has come to present a golden
rose to a young girl.  The idea is that he is to propose to this girl,
not for himself but for an old lech.  Some sort of ritual, I guess, but
as he hands this beautiful girl the rose, and as she takes it from him,
and he's not bad looking either, they fall in love with each other and
to hell with the old guy.  Every time I hear it I think of what she
told me about the record:

"This must be the only musical statement of the exact moment when love
begins."  I really do like this song even though you can't sing along
with it like some of the others."

As the two men listened to the glorious voices of two women from some
German opera company a flood of memory swept over Muley and he said
softly: "You'd laugh if there was a photo of the moment when I met
Marjorie and you saw it.  Because you'd see she really didn't even see
me.  I was working for her husband, the owner of the stores I was
serving, and when he came out to give me special orders, his wife
trailed along.  They were headed somewhere and he had stopped off to
speak with me.  And when I looked at him to hear what he wanted me to
do, I couldn't see him, for there she was in the frilly kind of dress
you'd wear to a dance or a reception for a bigwig, maybe the prettiest
woman I'd ever seen, and she wasn't sixteen, either.  She was ..."  He
chose his next word carefully: "Poetic, like they write about."  He
shook his head in disbelief: "I remember exactly what I thought at that
moment: Some guys have all the luck!  Imagine him owning all the stores
and having her, too.  She haunted my dreams."

"How did you get to know her?"

"In time my trucking firm grew almost as big as his stores, and it was
clear to anyone with good sense that his business was going down and
mine up.  It was then he suggested we become partners, in a manner of
speaking.  We saw a lot of one another, the three of us, but I never
thought of her except as his wife.  Mountains higher than me, both of
them."

Remembering those days, he said: "One night they took me to the opera.
Never been before.  It was this thing we just listened to, Norma, and
in the middle of the duet between the two women she trembled, gripped
my arm and said to her husband and me: "Poor woman!  It's so unfair!"
and it was then I realized she was not just a society lady but a real
woman with deep feelings."

As Muley ended the concert with a replaying of the Norma music he said:
"When he was dying he called me in and said: "Take care of Marjorie.
Lots of men will be after her money, I know some of them already. Don't
let her marry some damned fool.  Check him out.  Be sure he's worked
for a living."  ' "How did you and she get together?"

"It was a miracle.  I still don't believe it.  At the wedding I
trembled like a leaf."  As the great music from Norma filled the
apartment, Muley having turned up the volume, he looked at Zorn and
repeated with a smile: "It was a miracle.  Did it really happen?  I
pinch myself when I ask that question and get no answer, but she's in
this room with me now, always will be."

At the end of the great duet, Muley said: There was empty space left at
the finish, so Marjorie asked me to tape a song she loved dearly, but
it wasn't a duet.  It's another girl singer dressed like a man.  He's a
Greek god or something, and he's lost his sweetheart with a crazy name
something like Yurideechy, and he is searching through hell for her.  I
know his words in Italian: "Che faro Yurideechy?  Where is she?"

And suddenly, as the contralto sang this meltingly yearning aria from
Gluck's Orfeo ed Euridice, Muley, the truck driver who had married a
princess, looked pitifully at Dr.  Zorn and whispered: "I'm like him.
We both search through hell for the women we love, but neither of us is
going to succeed."

When Laura Oliphant was halfway through her treatment for cancer she
had decided, with Dr.  Zorn's guidance, to opt for the entire battery,
which would give her a 97 percent chance of survival-most of her hair
fell out, and she was distraught, taking her meals in her room and
refusing to allow friends to see her in this condition.

Nurse Nora, aware of Laura's self-imposed isolation, strode
purposefully down the first-floor corridor to find the poor woman
sitting listlessly in her sitting room.  Distressed to see the extent
to which this onetime strong school principal had been devitalized by
her bout with cancer, the nurse attempted to cheer her up: "Laura,
you're looking so much better."

"I look like a ghost," Ms.  Oliphant said weakly, 'a bald-headed
witch."

"Now wait a minute, Laura.  Hundreds of women undergo chemotherapy and
lose their hair.  But it grows back, stronger than before."

"Yes, but how soon?  I can't sit in this room till Christmas."

"Laura!  The world looks out for people with problems.  Brilliant men
and women work to find solutions, and yours has been around for two
thousand years."

"What are you talking about?"

"Wigs.  They had them in the pyramids, I've seen pictures-in color.

And today we have stores that specialize in selling them.  Near the
offices of doctors who specialize in cancer treatments.  I'm taking you
to one of those stores right now."

She was looking into Ms.  Oliphant's eyes when she said this, hoping to
give the woman courage, but the teacher shied away at the mention of
the word store, as if she'd had a bad experience in such a place.  Nora
told her to relax, and in a few minutes they were on their way in
Nora's car to downtown Tampa, where a medical district containing
several wig stores was easy to find.  Even though Ms.  Oliphant was
uneasy about entering one, for reasons Nora could not fathom, the nurse
prevailed, and within minutes of entering the shop, whose two
saleswomen were skilled in dealing with cancer patients, Laura was
inducted into the mysteries of wigs.

"They come in all styles and all prices," the saleswoman
explained.

"This least expensive one starts at forty-nine fifty.  We call it our
"cover-up and throw-it-away job," and many women on a limited budget
use it with complete success.  If a somewhat better wig is to your
taste, we have these beauties at a little over a hundred and fifty. And
over here are the imported masterpieces from Paris, high style, at
something over five hundred dollars.  What do you fancy, madam?"

Laura looked at the wigs, fingered the two cheapest and, looking at
Nora hopelessly, whispered: "Get me back home.  I'm not well."

The saleswoman treated Laura as if the latter were her daughter and
helped bundle her into Nora's car.  Before the car started, the woman
whispered to Nora: "Don't take it too seriously.  Women often suffer
shock when the reality of a wig hits them.  Jolly her along.  A week
from now she'll be laughing about this."

Nora had barely started her car on the road back to the Palms when
Laura covered her face with her hands and began to sob piteously.

When Nora slowed down to comfort her, she whimpered: "You don't
understand.  I'm the poorest resident in the Palms.  I live right at
the edge of destitution, and a wig at five hundred dollars-it's
unthinkable."

"But there was one at fifty."

"That's unthinkable, too, if it isn't absolutely required."

"But it is required-for your self-esteem-for your recovery."

Laura would say no more, except that when Nora walked her to her room
she stopped at the door and said: "It's all happened so suddenly, Nora.
And right in the middle of it I realized that I had no money, no close
friends, and that if my cancer spreads I shall one day soon be dying in
this room.  It's overwhelming.  Life isn't easy for an aging woman on
her own."

It was obvious to Nora that she had to help Laura escape from her
malaise, so she said firmly: "Bald or not, wig or not, you are going to
start rehabilitation work tomorrow with Mr.  Yancey and his wife, and
I'm going to speak to Mrs.  Mallory to see if she can cheer you up. Now
go to bed and I'll be back to see you at nine tomorrow."

Next morning, Laura reported to Mr.  Yancey, who took no notice of her
baldness: They tell me you had a cancer operation, Ms.  Oliphant.
Rotten luck, but you appear to be in good health otherwise.  I

know you had a hip operation and you walk so well you must have
been a model therapy patient.  Makes my job easier."  Taking both her
hands he began a series of broad, easy swaying steps intended to loosen
her upper torso.  Then he raised her arms gently to the point at which
she cried: "It hurts!"

"I know it does, but I wanted to see your limits.  Ms.  Oliphant,
you're way ahead of most mastectomies I see.  You're already on your
way to being rehabilitated, but I can help you speed it up," and he
moved her into a different kind of dance, one likely to relax the
entire body.  She complied, and by ten o'clock, after an hour of
carefully controlled exercises, she was actually smiling and had, at
least temporarily, forgotten her baldness.

Her meeting with Mrs.  Mallory had been arranged for ten-thirty.

Nora simply led her to the big double apartment on the seventh floor,
knocked on the door, told the petite former banker: "Esther, Laura's
here," shoved Ms.  Oliphant forward and left.

When the door was closed, Mrs.  Mallory said: "Let's sit over here on
this love seat overlooking the river and the swamp.  We may see some
deer."

She was not hesitant in getting to the heart of the matter: "Noraand
may God bless such women-informed me in strictest confidence, which I
shall honor, Laura, that you have money problems- Now wait, we all do.
Did you know that Chris was once sued for three million dollars?  She
also told me that you refrained from buying a wig, and God knows you
need one, because of the cost.  Well, my dear, I have a present for
you," and from behind the love seat she produced a square box of some
size.  Laura, wondering what was happening, noticed that the box was
decorated in red, blue and white with a drawing of the Eiffel Tower,
and when she removed the lid she saw a papier-mache baldhead atop which
rested a beautiful Parisian wig.

"Put it on," the owner said.

"It's yours."

"Esther-' "I too had chemo, my dear.  Three packs of cigarettes a day.
And this wig was a great consolation to me because I could look at
myself and say: "Well, Es, old girl.  You may have a leaky lung but on
the dance floor on Saturday night you can still knock 'em dead."

For some moments they discussed illnesses and Mrs.  Mallory said:

"You're about seventy-five.  I'll soon be ninety.  So if my wig
brings you as much luck as it brought me, you could have twenty years
more of a rousing good life.  At least take a shot at it."

She then left her seat overlooking the river, went to her desk and
returned with a long envelope: "My dear, Chris and I discussed your
case when Nora brought it before us, and we want to give you this
document, but you must pledge never to tell anyone in the Palms about
it or ever speak to us about it.  Go ahead, read it."

It was a lengthy paper, a transcription of sixteen pages purloined by
Nora itemizing all the medical bills pertaining to Ms.  Oliphant's
cancer treatment, including the heavy fees of the seven doctors she had
consulted.  It came to forty-one thousand dollars, of which Medicare
had paid more than half.  All remaining charges for which Laura was
responsible were marked in red ink: "Paid in full."  The Midwestern
banking couple had decided to help this retired schoolteacher start her
final years with a clean financial slate, freed from the devastating
fear of running out of funds and with no place to which she could
retreat.  Laura returned to her room in a daze, studied the papers that
would rescue her from poverty and broke down in a flood of tears.

That first night she was apprehensive about appearing in the dining
room in the elegant Paris wig, but when she dressed in one of her most
attractive outfits and put on the precious wig, she had to admit that
she looked fairly presentable.  Gingerly she left her room, pleased to
see that there was no one in the hall, and walked slowly to the dining
room.

When she entered that center of social life she became aware that
everyone was looking at her, and some called out greetings, but no one
mentioned the wig: "How grand we look tonight!"  and "Laura!  You've
done wonders since your stay in the hospital," and before the dinner
ended she was again a full-fledged member of Palms society.  Such
universal support spurred her recuperation until both she and her
doctors could say the treatment was a success, and she reverted to the
comfortable routine she had known before: the visit to a nearby church
on Sunday, working in the flower gardens in the late afternoons and the
intense bridge games after dinner.

The greatest change in her life, however, was that now both Dr.

Zorn and Nurse Nora suggested, whenever a woman resident faced the
probability of cancer of the breast-and it happened regularly-that

she might want to talk with Ms.  Oliphant, who knew a good deal
about the problem.  This happened in the case of Mrs.  Clay, a birdlike
woman from one of the single rooms, who accepted the suggestion.

Nora and Dr.  Zorn watched as Laura sat with the woman in a corner and
outlined the options, as Laura had learned them from her own
experience: mastectomy or lumpectomy, followed by radiation or
chemotherapy, and then maybe treatment with Tamoxifen.

"What do you advise, Ms.  Oliphant?"

"Unfortunately, no one can make up your mind for you, not even the
doctors, because there are a lot of different schools of thought on
cancer treatment."

"But they tell me you've had breast cancer.  What did you do?"

"All three-mastectomy, chemotherapy and Tamoxifen.  And I feel good
physically.  I'm at ease psychologically.  I did lose my hair, but
it'll come back.  For the present I wear this wig."

"What did it cost?"

"About six hundred dollars in Paris."  When she heard Mrs.  Clay's
surprise, she added quickly: "I didn't buy it.  A wealthy friend gave
it to me after she had used it.  But you can find perfectly usable ones
for less than a hundred.  You wear it only a few months."

"I didn't mean the wig.  The operation and the other things.  What did
they cost?"  She felt she must apologize for such intrusive
questioning: "I don't have a great deal of money, you know.  How
much?"

"I think everything ran something like forty thousand."  When Mrs.

Clay heard this figure she gasped, and Laura said: "Mine must have been
extra expensive.  I had to consult six different doctors."

"Did Medicare cover some of the cost?"

"With our crazy system of health care, only a portion.  But the
information I've just given you is free.  Do it right, ninety-seven
percent success.  Refuse to do anything, we'll bury you before
Christmas.  But only you can make the decision."

Mrs.  Clay, this frightened, friendless little woman, was terrified by
what Laura had told her and by her reluctance to give specific
guidance: "But what am I to do?  If you've been through the procedures
and don't know, who does?"

Laura was deeply affected by this desperate cry for help.  She stuck
out her jaw and said almost defiantly: "All right!  I'll tell you what
to do and save you fifteen thousand dollars.  Don't consult any more

doctors.  Don't spend any money on exploratory surgery that
merely tells the doctors what they already know.  Go the whole route,
but do it at the little hospital where charges are less, and then fight
Medicare to pay the maximum."

"You think that way I can afford it?"

Almost without being aware of what she was doing, Laura grabbed the
little woman as if the latter were one of her students and shook her:

"Damn it all, woman.  This is your life.  Of course you can afford
it."

Startled by the fury with which she had spoken, she calmed down and
spoke in a soft, loving voice: "Mrs.  Clay, if you have to change your
habits to save the money, if you have to borrow from family, if you
have to do only God knows what, do it.  We're talking about life, which
is precious."

Close to tears, she suddenly cried out: "I'll tell you what else!  By
the time you get out of the hospital I'll be through with this wig, and
it will be yours.  You'll start your new life in a six-hundred-dollar
Paris creation," and impulsively she whipped it off her head and jammed
it down on Mrs.  Clay's.

The two women stared at each other, Laura with her bald spots, Mrs.
Clay smothered by a wig too big for her, and they burst into laughter.
Dr.  Andy, who had been watching Ms.  Oliphant's performance closely,
quietly turned to Nora: "She's recovered her spirits.  I wonder what's
happened," but Nora, knowing about the secret financial relief the
Mallorys had provided, only explained: "That Paris wig.  No matter how
old a woman gets, when she looks good she feels good."

When John Taggart assigned any young man to a position of importance in
his organization, he allowed him free rein for much of the first year.
The four roaming inspectors of his retirement empire did report
occasionally on young Andy Zorn, but only in connection with some
innovation that they had initiated.  They did not spy on Zorn himself,
and Taggart never allowed a director's subordinates to undercut him.
But Taggart was glad to pick up stray bits of information from
disinterested visitors to a center like the Palms, or incidentally
from

Zorn's underlings like Miss Foxworth and Ken Krenek.  In late
April Krenek sent a letter that fell into this category because it
mentioned the request of the scientist Maxim Lewandowski that he be
allowed to rent, on behalf of the notable scientific societies for
which he worked in his retirement, an unused closet like room on the
fourth floor: "He says he needs more space for his new computer, which
the consortium of universities is giving him, and for files to hold the
paperwork the computer will develop.  Miss Foxworth says the rental
proposed by the universities is not generous, nor is it so low as to be
ridiculous.  In view of our constantly improving financial status, the
request has been approved by Dr.  Zorn, who said: "Who knows?  The old
fellow might discover something that wins him the Nobel Prize!"  .. .

"I must add in closing that both the staff and the residents have taken
to Andy Zorn with enthusiasm.  He is vigorous and perceptive, and has a
friendly manner and an urgent desire to master this business.  Day
after day he roams the place, eager to learn about everything that
functions and especially about those parts that don't function, which
he is determined to fix."

On one such inspection late in the spring, Zorn came upon one of the
small enclaves provided for chess players, bridge players and people
who wished to read in quiet surroundings or have tea with a small group
of friends.  It was empty at the moment, but someone had left on the
bridge table a copy of the glossy magazine Retirement Living.  He knew
of the journal, of course, but was not familiar with its contents, for
he supposed it to be frothy and of little use to him.

However, when he casually leafed through the color pages, he came upon
an article that commanded his attention.  Written at some length, it
told the story of a registered nurse and of her education, her early
work in southern hospitals, her salary, her expenses, and the curious
twists in her profession whereby she became a head nurse in one of the
fine retirement centers in North Carolina.

He had read only a few of the tightly written paragraphs when he took
the magazine from the table and sought a corner chair in which he could
read the entire article.  As he finished the last paragraph he closed
the pages reflectively and said: "I feel as if I know the woman.

She's a real person with real problems and accomplishments.  I wonder
who wrote this?"  and, turning back to the beginning, he saw the brief
editorial note in italic at the foot of the first column of type:

Pepper Riley, graduate of the University of Missouri's School of
Journalism, has worked in the health field for a dozen years and has
written widely about it.  She is a regular contributor to this
journal.

Slumping in his chair in deep thought, he tapped the closed magazine
and lost himself in imaginary situations: Think what a writer like that
could do with a story about a center as fine and varied as the Palms!

Done properly, it could attract the attention of thousands.  But no
amount of hard thinking produced answers to: What kind of story?

Focused on what aspect?  Photographing whom?  He had no answers, but
the basic validity of his conclusion remained with him: Our story is
one that's worth telling.

With the magazine rolled up in one hand, he hurried down the corridors
to his office, resembling a relay racer carrying a baton.  Once in his
chair, he summoned Foxworth, Krenek and Varney, and as they looked at
the magazine he told them about what he had in mind: "A six-page
article on the Palms, full color, written by Pepper Riley.  It could
leapfrog us right up to the head of the pack.  I'm sending a fax to the
editors this afternoon, but what to tell them that will excite their
interest?"

As the discussion continued, Zorn returned repeatedly to the journalist
Pepper Riley: "She wouldn't waste her time on trivialities."

Krenek was strong in voicing his counsel to go slow: "You don't know
these people.  You've never met this sharp-eyed Riley woman.

And don't forget, what you tell a reporter isn't necessarily what she
writes.  They can spot something faulty here and blow us out of the
water.  I don't like the idea."

As they argued, Nora was reading about the other trained nurse who had
found a good life in the health wing of a retirement center, and during
a pause when the other three were staring at their knuckles, she said:
This is great stuff.  It tells the story-my story, really-through good
words and wonderful pictures.  If we do it, we have to focus on one of
our people.  But which one?"

Zorn thought that Ambassador St.  Pres might be a contender, but Miss
Foxworth torpedoed that idea: "Stiff as a post, and what's the story?"
But as the discussion intensified, one resident after another being
disposed of, she suggested: "The story isn't someone who's al ready
here in residence.  The real story is why someone out there might
reasonably want to move in," and as soon as she said this, all four
minds agreed, and the ideas exploded.

"It's got to be a widow.  Her husband has died leaving her a big
house."

"Limited funds but not a pauper."

"From some interesting state that photographs well, like maybe
Kentucky."

"She's going to leave that monstrous house, all that furniture, and
move down here to a two-bedroom apartment."

"No!"  Dr.  Zorn shouted.

"I see it all.  Moving from a big house to a one-room special.  That's
the story.  Every woman could empathize."

"If she has this big house and her husband left her in comfortable
financial conditions, why is she confining herself to one of our small
rooms?"

Krenek solved that: "I'm amazed at how many of our widows arrive here
thinking they have more money than they do, but they soon face reality.
And they take a one-room affair for the same reason Laura Oliphant does
and half a dozen others.  That's why we have one roomers because not
only these widows but also single women have to be careful with their
funds."

Soberly, Andy concluded: "We could have the story of a widow from
Kentucky, or wherever, who faces a crisis in her life.  The end of a
wonderful life in a big house with her husband, the beginning of an
acceptable new life in a small room alone.  And then-now we get to the
heart of the story-in the Palms she is not imprisoned in that one small
room.  She has the full richness of a great mansion," and in a rush of
words he explained the photographic shots that would be possible: "We
see her playing bridge with three attractive partners.  Shuffleboard.

Exercise room with the Yanceys.  Movies in the recreation room.  Chess
one-to-one against Senator Raborn.  Dining with friends.  Library, our
Sunday evening prayers, fishing with Judge Noble and his birds.  God!

this could be magnificent!"  and afire with that enthusiasm he drafted
a fax to the New York offices of Retirement Living, praising the
editors for their fine article on the nurse in their February issue and
inviting them to do an even better story on a bereaved widow making her
big decision to sell off her house and move to what the average reader
would call a nursing home, but this-the Palms-was a home with a

vast difference.  He suggested that Pepper Riley would be ideal
for writing the story.

To his astonishment, next morning at nine-thirty he received a
telephone call from the managing editor of Retirement Living: "We
rarely receive proposals, and we get a lot of them, with as clear a
statement of possibilities for a story suited to our needs.  Pepper
Riley is sitting here with me and she says it sounds like a natural for
her, and she's our best.  But that's no commitment on our part.  You
have to agree to certain conditions before we can even talk.  Now I
want you to take down these requirements.  One, the subject must be
photogenic, not Lena Horne-beautiful at her age, but what you might
call blue-hair good-looking like in the jewelry ads when he's giving
her an extra diamond on their fiftieth anniversary.  Two, she must
still have her big house available so that we can photograph her
heartbreak in leaving it.  Three, she must be willing to talk with us
openly and honestly about her financial position.  That's an
obligation, because without her compliance we have nothing.  And we
will not accept her playing coy and saying: "John left me comfortable."
Readers insist on more than that.  Four, when she reaches your quarters
you must be able to surround her with five or six men and women of
above-average attractiveness.  We pay for visits to the hairdresser. 
Five, you must play honest with us in every detail about your financial
arrangements with her.

Talk it over with your staff, Dr.  Zorn.  Make them understand that our
five requirements must be met, and if they are, Miss Riley and I have a
gut feeling that this project could prove to be a live one."  As he was
about to hang up, the editor added: "Oh, Dr.  Zorn!  The widow's
agreement to provide us with the details I mention is made with us, not
you.  We've learned not to accept blind assurances like "I'm sure we
can arrange that."  We'll do the arranging.  Good luck."

When Andy informed his staff of the five demands, they started
immediately to sort out recent inquiring visitors who might satisfy the
magazine's needs.  Both Foxworth and Krenek were invaluable, since they
remembered recent applicants with surprising accuracy.  One after
another the two experts rejected candidates: "Not for a national
magazine."

"She sold her house a year ago."

"That one would be possible, but she's taking a two-room apartment."

With a cry of delight, Miss Foxworth looked up from her papers: "I have
her right here.  A delightful widow who visited us from a small town in
Arkansas, husband was a lawyer, who left reasonable funds, but she has
to watch her pennies.  She's found a buyer for the old house, is moving
out shortly and coming down here in two weeks.  Taking one room, very
nice with a view of the water.  Her name is Arlene Jessup, and here's
her phone number."

"But is she photogenic?"  Krenek asked, and Miss Foxworth said: "By my
standards, yes.  I hope I look as good as she does when I'm in my late
sixties, but I fear I may have lost that battle already."

"Stop it, Roberta!"  Zorn said.

"You know you're attractive, and you're probably the most intelligent
person on our team."

That's been the bane of my existence," Miss Foxworth replied.

"I

never look half as good as I sound.  But it doesn't matter-I've become
really excited by this project.  It's a great idea, Andy, and we've got
to carry it through."  She volunteered to call the widow Jessup and
propose the story to her, and she made the project-both the
photographing in Arkansas and the special introduction to the Palms-so
alluring that Mrs.  Jessup agreed.  A fax was sent to New York giving
the positive and enthusiastic details, and word was returned:

"Have talked with Jessup, sounds ideal if she has acceptable
appearance.

Assigning Pepper Riley to story.  She and our world-famous Austrian
photographer on their way to Arkansas immediately to shoot removal from
Jessup's big house.  Riley and her crew should be with you in ten
days."

When Pepper Riley reached the Palms, with the Arkansas half of her
story already in draft form, she was a new experience for Andy Zorn.

Two years younger than he, she had been a nurse in a variety of
health-care institutions: hospital, nursing home (a horrid experience),
top-scale retirement center in North Carolina, and county nurse in the
Carolinas.  At the advanced age of twenty-seven she quit her nursing
job and enrolled in the University of Missouri's School of Journalism,
where she took a degree in writing about science and health.

Upon graduation with good marks, she quickly landed a job with a Kansas
newspaper, where her writing attracted favorable attention, and this
led to an apprenticeship at the age of thirty-two with Retirement
Living, where almost immediately she was promoted to staff writer and
then to feature writer.  An unbroken series of excellent stories
followed, and now she was in Tampa to sustain her record.

Her rapid rise in her profession had made her self-assured, if
not arrogant, for when Dr.  Zorn presumed to advise her about how he
thought the Tampa half of her story should develop, she told him
curtly: "Let's understand one thing at the start, Doctor.  I decide
where the story is going and how," and he retreated.

She brought with her a team of three: a young woman who served as her
assistant, looking after the script and the details; Fritz, the
Austrian cameraman, fifty-one years old and showing signs of aging;

and his assistant, a lanky young fellow with a pigtail and one earring
who was a master at lighting-with a square of reflecting metal, a white
sheet, a newspaper and a variety of booms and klieg lights he could
either make a scene seductively romantic and filled with mysterious
shadows or throw a blazing spotlight on a face to reveal the crags and
lines that indicated character.  Fritz told Zorn: "That boy is my
credit card.  I won't leave home without him."

When the Palms command crew saw the photographs taken in Arkansas, they
were elated, for they sensitively captured the sad aftermath of the
death of a loving husband, surrender of a cherished home, disposal of
furniture and objects assembled over a lifetime, and the beginning of
the great loneliness that awaits so many.  One picture seemed to tell
it all.  Mrs.  Jessup stood by the window of an empty room, looking out
at a bleak landscape.  The lighting genius had kept the room in deep
shadow, played a soft light on the woman's profile and used a spot to
illuminate a forlorn tree that stood some distance from the house.  The
result was a masterly depiction of a person totally alone.

Although the widow Jessup arrived with more furniture than could be
fitted into her one-roomer, the son and daughter who accompanied her
were happy to turn the extra pieces over to an antique consignment
dealer.  The three Jessups were a delightful trio, she in her late
sixties, they in their early forties with every sign of having been
well cared for.

Miss Foxworth substantiated the financial figures provided during the
interviews in Arkansas: "Mr.  Jessup, a small-town lawyer, had lived
well in a big house with three bathrooms but had left his widow only
$260,000.  She was able to sell the big house, rather outmoded, for
$176,000 because it carried with it almost half an acre of desirable
land.

Since her children made it clear that they expected no bequest from
their mother when she died, they encouraged her to enter the Palms on

the no-return-of-capital principle and she chose one of our least
expensive one-roomers.  This meant a lower monthly fee, in her case
$110,000 for the buy-in, and only $917 for the monthly fee.  Because
she loved her children she opted for a 50 percent recoverable for them
at her death."

Zorn could not recall a more equitable arrangement.  It left Mrs.

Jessup with a substantial sum to be invested so that she would have the
interest to use as spending money.  He wished that all transactions
were as amicably put through.

But as Zorn worked on the Tampa end of the story he quickly found that
the strong characters involved in this project had three separate
agendas: Pepper Riley was determined to tell her story her way; Fritz
would shoot the pictures his way, regardless of what Pepper
suggested;

and he, Andy, was determined that the Tampa segment tell the story of
the Palms in a way so favorable that a reader, studying the elegant
text and looking at the strong pictures, might want to fly down to
Florida and take a look at the place-he hoped that some of these
sightseers might become interested in taking an apartment or, in later
years, to utilize the health services.

Pepper would have none of that.  A handsome young woman who could look
quite intriguing when she smiled, she could also be rock hard when
required: "I am not here to glorify your nursing home," she told Zorn,
aware that her linking the Palms with an ordinary nursing home would
annoy him, and she certainly meant what she said.  Trouble came when
she and Fritz spent most of one day photographing Mrs.

Jessup tucked away in her one room.  They showed her converting her
sofa into a bed, showed her edging into and out of the bathroom, and
photographed her huddled at one extreme edge of her cramped quarters.
The pictures made the constricted area look almost repulsive.

When they continued exposing the room's deficiencies well into the
afternoon, Zorn had had enough: "Damn it!  She doesn't live in this
room twenty-four hours a day!  She has the full run of this spacious
and well-appointed installation.  That must be shown, too."

Pepper listened and tried to hide her impatience with his complaint,
then said almost as if speaking to a child: "My dear Dr.  Zorn.  Don't
you suppose I understand the necessity for an upbeat conclusion to my
text?  Do you think I'm so stupid as to ignore the inevitable?"

Humbled by Pepper's repeated rebukes, Zorn was tempted to feel

sorry for himself, the manager who was not allowed to manage, but
one busy afternoon he discovered that he was not the only one who was
being put down.  Fritz was snapping at Pepper rather nastily because
she had ruined one of his shots by trying to interview Mrs.

Jessup when he required the widow's full attention.  Pepper waited till
Mrs.  Jessup had wandered off to her next setting, then she unloaded
her wrath on her white-haired photographer genius: "Listen, old man,
I've been covering for you on our last three jobs.  I do everything to
make you look good.  Well, Grandpop, I'm serving notice I will not take
any more of your petulant bullshit.  Keep it up and when I get back to
New York I'm going to tell them you're over the hill.  You can't pull
your weight in these assignments, and I will not go out with you ever
again.  But if you stop the crap, do your job and keep your big mouth
shut, I'll continue to make you look good and you can probably hang on
for another two or three years.  But don't you ever yammer at me like
that again."  The old cameraman had no response.

When they finished shooting what Zorn called 'the ghetto shots," they
turned to the new life that Mrs.  Jessup would be enjoying, and here
Fritz used his cameras in a fully upbeat way.  He showed her in a
charming mix of scenes, walking beside the channel to talk with Judge
Noble and inspecting his birds, or roaming in the African veldt, or
looking down the beautiful entry lane of tall Washingtonias.

Even more gratifying to Zorn were the shots of her making friends in
the library, watching the men play billiards, or sitting in as a fourth
at bridge, helping in the garden with the flowers, or going on a bus
trip to the Dali Museum in nearby St.  Petersburg or to the Ringling
Brothers circus museum in Sarasota or to the exquisite new marble art
museum in Ocala to the north.  She took a day trip to Disneyland's
Epcot Center and attended an orchestra concert in Clearwater.  Some of
the most interesting pictures were those of Judge Noble and her as they
took a nature walk in a wild area north of Tampa and then as they
enjoyed a dinner-paid for by the magazine-at the Colombian Restaurant,
where they were entertained by flamenco dancers.

But the sequence of shots that really impressed most viewers were the
photos of the Mallorys' inviting Mrs.  Jessup into their big Cadillac
for the drive to the posh Berns' Steak House in Tampa, and then to a
public dance at which Mr.  Mallory, nearly ninety, did fancy steps with
the new widow.

Pepper did not allow Mrs.  Jessup to gush over any of her
experiences; she turned off her recorder whenever effusiveness
threatened to slip in, but she liked to catch the newcomer's surprise
at the richness of life awaiting her once she left her little room.
Pepper also caught couples who had been in residence for some years
saying:

"We should have come here ten years earlier than we did," but she also
snooped around until she found a bitter elderly woman who was moving
out, and her comments, eagerly spewed onto the tape, were scathing:
"They charge double what they should.  The people are boring, the food
is dreadful, and come summer in this climate you swelter."

"Where are you going?"  Pepper asked.

"Back to Vermont, where people are civilized."

"Aren't the winters pretty cold up there?"

"Yes, but you have libraries and you expect your neighbors to have read
books, too.  Worst decision I ever made in my entire life was moving
into this area of cultural wasteland.  Television six hours a day, and
the yogurt machine is never working.  If you moved in here at your age,
you'd commit suicide within a month."

"But it wasn't intended for people like me."

"Nor for people like me either, whose blood is still circulating. God's
Waiting Room they call it when no one's listening.  When He wants me He
can find me just as easy in Vermont.  That's where I'll be." Pepper
incorporated such comments in her story to give it the needed spice.

Her lively prose and Fritz's vivid photographs depicted so enticingly
the lifestyle 'among the sixties and the seventies," as the magazine
called it, that three days after the team left, Pepper could send Zorn
another fax: "Story so smashing they're allotting us eight pages."  And
when John Taggart heard about the story and saw early proofs of it, he
found it so accurate in showing what he was trying to do that he
ordered a thousand reprints for each of his eighty-seven centers, which
distributed them widely.

Some who received copies came to inspect the Palms, and when they did
they invariably asked whether they might meet Mrs.  Jessup, who was
always gracious in assuring them that the center was even more pleasant
than the article had shown.

Zorn, happy to see such positive reactions to his brainchild, sent
Pepper a three-word fax: "You done good."  But he felt no desire to
host any more press crews at his Palms.

If the Duchess had not been such an inveterate snoop, the members
of the tertulia might not have uncovered the Reverend Quade's secret.

When the postmaster arrived with a package too large to be included in
Mrs.  Quade's locked postal box, he had to leave the bulky bundle
leaning against the row of boxes on the floor.  This was an invitation
to the Duchess to inspect from whom and from where the parcel had
arrived, and she saw, with some excitement, that it had been mailed by
the New York publishers Doubleday and obviously contained a
manuscript.

Senator Raborn was passing by when the Duchess made this tempting
discovery, and he heard her tell others at the mailboxes: "It looks
like our Reverend Quade has written a book."  Her listeners, inspecting
the package, were easily convinced that the Duchess's assumption was
correct.

As the four tertulia members convened that night for dinner, Raborn
told them: "I think it's highly likely that our Mrs.  Quade is about to
have a book published."  When the others heard about the package, they
suggested that a fifth chair be added to their table and sent editor
Jimenez to intercept Helen as she entered the dining room and escort
her to their table.

When seated she asked quietly: "And to what do I owe this signal
honor?"  Senator Raborn explained how the Duchess had happened to see
the telltale package: "We are intensely curious as to what it might be
that you're writing."  Quickly he added: "Assuming, of course, that
Mrs.  Elmore's deduction was correct."

"It was," Mrs.  Quade said with just a touch of asperity.  She was
irritated by the snooping but also pleased by the fact that these
somewhat aloof men had discovered she was writing a book, an activity
they had probably thought was restricted to their own sex.

"May we ask," President Armitage said as he leaned toward her, 'what
the subject matter is?  Commentary on the New Testament as it applies
to contemporary living, perhaps?"

Ignoring his somewhat condescending manner, she first attended to
giving her dinner order, then looked up and smiled at the men: "It's

nearly ready for publication-I'm correcting galleys.  It's
entitled Likewise the Mistress, Too."

"Now, what could that refer to?"  Ambassador St.  Pres asked.

"It's a phrase that reverberates, but I can't place it."  Turning to
face her, he asked: "It is a quotation, I believe?"  and she nodded,
launching into a description of the song from which the quotation was
derived: "One of the cherished songs of Christmas, dating way back to
the time before the sentimental carols, was "The Wassail Song."  Its
words are simple, its music haunting, evoking memories of snowy
yuletide scenes in seventeenth-century England.  One can almost see a
dozen men and boys stomping their feet to keep warm as their voices
ring out in the chill night air.

"In the recording I have, which I bought in London one Christmas, a
couple of lines captivated me.  I'd been invited over to England to
explain to church groups how I had become one of the first women in
America to be ordained.  It had shaken the British establishment and
I'd been greeted with a mixture of cold courtesy and obvious
distaste.

After one testy interrogation I was walking back at dusk to my hotel
when I heard from a music shop the opening chords of "The Wassail Song,
and it seemed so Christmasy, so very right in its celebration of good
fellowship, which under the circumstances I sorely needed, that I stood
transfixed as two lines struck me as exactly defining my position."

"I don't think any of us know the words.  It's not a popular Christmas
song here," President Armitage said.  She nodded, and brought up the
phrase that had provided the title for her book.

"The song was sung by a professional chorus, with the men's voices
vigorously singing "God bless the master of this house .. ."

following which, almost as an afterthought, the boy sopranos-they'd
allow no women in a chorus like that-sang in high sweet voices
imitating women:

"Likewise the mistress, too."  ' She had half sung these words, and in
the silence that followed, the men of the tertulia looked at one
another and shrugged their shoulders,

but Senator Raborn asked: "The significance?  What could the
heavy significance of such casual words possibly be?"

When the others also admitted being baffled, she said quietly: The
second line seemed a paradigm of my life-especially my life that
difficult, wintry week in London."

"Please explain," President Armitage said softly, for he recognized in
Mrs.  Quade's delivery the voices of several women professors who had
come to his office at the university with deep grievances against the
academic tradition of male professors' blocking the promotion of their
female counterparts, and he was not mistaken in guessing that Mrs.

Quade was of that distinguished sisterhood.

"The words, and the offhand way in which they were delivered, as if
this were a sop thrown to a lowly peasant-a generous afterthought were
directed specifically at me.  The male voices sang of important things,
the "female" voices were acknowledged but never taken seriously."

"What did such an experience do to you?"  the ambassador asked, and she
replied carefully, for she was aware of the negative impact her words
were going to have: "The words confirmed what I've known for a long
time.  Made it brutally clear."

"Now, what could that be?"  Senator Raborn demanded, almost
truculently.

"A simple Christmas carol.  A simple phrase."

To you it would have sounded quite simple, I'm sure," she said, 'but to
me it reiterated what formal religion has always taught, that women
have inferior stature-that they are, indeed, to be despised."

Her words were bombshells, for not one of the four men was prepared to
accept such a brazen condemnation of the churches that had sustained
them and, leaving theology aside, to which they were in large part
indebted for their success in life.  Armitage and Jimenez had attended
church-run universities.  Senator Raborn had won his first election to
his state's House of Representatives because a plurality of churchgoers
had voted for him instead of his Democratic opponent, who had been
accused of atheism, and the ambassador had served with ease and
distinction in two Catholic countries.  Each man wanted to challenge
Mrs.  Quade, but before anyone could do so, she strengthened her
accusation by citing episodes from her extensive experience.

"I went to a Quaker school, one of the most liberal in the nation, but
when we attended Sunday meeting in the little towns nearby, men were

on the left as you entered the house of worship, women strictly
on the right."

That sounds as if they were given seats of honor," St.  Pres suggested,
but she corrected him: "That was how you saw it when you entered, from
the back, but when you sat on the facing bench from which the meeting
was conducted, you saw the powerful men on the right, where they
belonged, the weak women on the left, where they were ordained to
sit."

That's a preposterous conclusion to reach from accidental seating,"
Senator Raborn protested.

"Not so preposterous, for who sat on the facing bench, as if they were
cardinals of the Catholic Church or deacons in the Baptist?

Mostly men, as it has always been throughout the history of
Quakerism.

Who were the lay people who became known as Quaker ministers through
the force of their speaking in meeting?  George Fox, John Woolman,
Rufus Jones."

"Have you suffered because you were one of the first women-' began
President Armitage, but Mrs.  Quade ignored his question and cut him
short.

"Primitive religions placed intolerable burdens on their women.  In
some societies a woman could be executed if she allowed her shadow to
fall across the tribe's major fishing canoe.  I could cite a hundred
curious laws that disciplined women when they were menstruating.  Men
feared and hated women because of the arcane powers they had.  They
could bear babies.  They sometimes saw things that men couldn't see, so
such women were branded as witches and either burned or hanged."

"You're speaking of primitives," Jimenez argued, for he took her
charges seriously and did not want them to stand as unchallenged truth,
but his words led Mrs.  Quade to the core of her argument: "From the
primitives, organized religions adopted the same strictures.  When I
taught in Pakistan I studied how Islam denigrates its women.  They're
not even allowed to pray alongside the men in the mosque.  And how
they're treated in nations like Arabia and the Emirates is a
scandal."

"But your Pakistan elected a woman as prime minister," St.  Pres
pointed out, and she snapped: "Yes, and didn't they get rid of her as
soon as possible?  And in the ugliest way, primarily because she was a
woman."

While the dishes were being cleared and dessert orders taken, Mrs.

Quade progressed to her most contentious points: "When I was
stationed briefly in Israel, working with the rabbis, I attended a
synagogue each Friday at sunset.  No prayers could be said, nor the
Torah read, unless ten men were present, a minyan.  Women did not
count.  And those women who did attend the services-there weren't many-
had to sit in an upper balcony behind a gauze drape to keep them from
contaminating the worship below, and perhaps-who knows?-to keep from
casting an evil spell on the Torah itself as it perched there in its
sacred scroll."

"Ridiculous!"  Jimenez cried.

"I've known scores of Jews.  They revere their women," to which Mrs.
Quade said in a low voice: "And what prayer, centuries old, does the
Jewish man say as he admires himself in the bathroom mirror each
morning?  It ends: "And thank God I am not a woman."  ' She was also
harsh on the Mormons, saying that they kept their women in a secondary
status, disciplining them severely if they stepped out of line, and
when the men at the table protested because they knew Mormon men who
treasured their womenfolk, she said: "The public record is too clear.
You don't have to accept it if you don't want to, but women of other
faiths know it's accurate."

She ran into vigorous opposition when she started to speak about the
Bible itself and its constant placing of women in an inferior position,
but she could point to Saint Paul and his almost savage disciplining of
women as if they were troublesome children, and she quoted some of
Paul's more famous remarks, such as "It is good for a man not to
marry," and "For man did not come from woman, but woman from man," and
"Women should remain silent in church.  They are not allowed to speak.
If they want to inquire about something, they should ask their own
husbands at home."

St.  Pres said: "We all know that Saint Paul was a misogynist-he spoke
only for himself," but it was Jimenez who struck the decisive blow: "I
don't think you're quoting Saint Paul correctly.  I remember the
English words as being somewhat different," and she had to confess:
"Like many modern clergy, I use the New International Version," and
each of the men said: "Oh!"  as if that removed her from serious
consideration.

The arrival of dessert provided a recess from an argument that might
have taken a tense or even ugly course, but when the plates were

removed, St.  Pres made a suggestion that all approved: "Your attitudes
are so concisely phrased, Reverend Quade, that we'd profit from hearing
more.  This is all rather new to us," and Senator Raborn agreed: "Yes,
the voice of the New Woman."

Unfortunately, editor Jimenez got the postprandial discussion off to
the worst possible start by giving it as his judgment that 'at least
the Catholic Church has always held women in the highest regard,
certainly the equal of men and often their superiors."

"I do not find that in the record of your Church," Mrs.  Quade said,
trying not to sound contentious, but Jimenez bristled: "I think if you
look at the way my Church has glorified the Virgin Mary, giving her
every honor mentioned in the Bible, you'll have to admit that we revere
Mary, and have always honored her as the symbol of womanhood."

Mrs.  Quade at first seemed to accept this defense in silence, looking
down at her fingers, clasped together as if to form a steeple.  Then,
looking up at the four men and not speaking exclusively to the editor,
she ticked off a series of facts that she knew to be accurate through
long study of original documents: The Bible says little about Mary's
deification, nothing about her perpetual virginity except that Jesus
had brothers, born presumably after his birth, and nothing about her
ascension into heaven."

Editor Jimenez threw down his napkin: "Those very attributes form the
soul of what our Church teaches about Mary!  Truth irrefutable."

Very quietly Mrs.  Quade said: "None of those concepts appears in the
Bible, nor in any other source until the Church Fathers promulgated the
belief in A.D. 431 at one of their great councils-at Ephesus, I
believe-and they did it, we think, to satisfy the growing complaints by
women that they had no place in the Church.  It was a bold move, and a
thoroughly responsible one, a happy invention to save the Church."

"I cannot believe that," Jimenez protested, and the other men's
agreement was voiced by St.  Pres: "From what I've witnessed in the
Catholic countries, the Virgin Mary stands at the very heart of the
Church.  You could almost say that she defines it."

Never raising her voice, because she knew she was on solid ground,
Reverend Quade said: Today, yes, the Church has adopted Mary most
effectively.  But in the beginning three centuries she was not
conspicuous, either in the Bible or in Church doctrine."

Then where did her divinity come from?"  Jimenez demanded, and
the clergywoman replied: "From a handful of popular treatises, and
would-be additions to the Bible, and from legend.  Remember that when
the Church Fathers finally decided to present her to the world with the
attributes we revere today, the general public went wild with
celebrations.  It was one of the most widely accepted judgments ever
handed down by the Church, that henceforth Mary was certified to have
been a perpetual virgin, born and living with no knowledge of sin, and
the special mediator between human beings and the Godhead.  It started
with that."

Jimenez, outraged, rose from the table, bowed to the other members of
the tertulia, ignored Mrs.  Quade and stomped off with this parting
shot: "I do not wish to associate with heretics.  Popular legend!  It
defames the word of God as given in the Holy Bible."

When he was gone, Senator Raborn said: "Well, you certainly stirred up
a hornet's nest, Mrs.  Quade."

"It's only the truth."  She nodded to her hosts, then added a telling
point: "Everything I said was developed by Catholic scholars, the great
men of the Church, centuries before Martin Luther was born.  Catholics
produced some of the finest theologians the world has had.  They knew
they needed Mary."

For three days editor Jimenez was absent from the tertulia, but his
chair was taken one night by Lewandowski, who spoke further about
developments in the Human Genome Project.  Specialists in various
nations were identifying one gene after another which accounted for
specific diseases and imperfections in human development: "Last month
it was discovered that an irregularity on chromosome seven seems to be
a principal cause of cystic fibrosis.  At the speed we're working in
even the little laboratories we can expect miracles by the end of the
century."  St.  Pres spoke for all when he said: "I'm not sure I want
to see all your miracles, Lewandowski," and the others laughed.

On the fourth evening editor Jimenez returned to the tertulia, pulled
up a fifth chair, walked sedately to where Reverend Quade was sitting
alone and said, as if he were a courtier addressing a queen: "Would you
grace us with your presence tonight?"  With a slight bow she rose, took
his arm and accompanied him to the corner table.

"I have invited Helen to join us," he explained, 'because I owe her an
apology," and as the men wrote out their dinner orders, he continued:

"I've spent the last three days in libraries, checking on the
veracity of what she said the other night about the history of the
Virgin Mary in the life of the Catholic Church.  I used Catholic
studies mostly and can now assure you that almost all she told us that
night is true.  I apologize," and he leaned across the table to kiss
her hand.

"What exactly did you find?"  President Armitage asked, and Jimenez
replied: "Most fascinating.  The Church Fathers wanted desperately to
find in the Bible some proof that would substantiate the idea that had
become so popular with the general public, because of the legends and
the colorful tracts.  In the New Testament they could find nothing, not
a word, just as Helen said.  But a very clever scholar at the end of
the fourth century, when Mary had been dead for more than three hundred
years, found in the Old Testament a cryptic passage written by the
priest of the Temple, Ezekiel, some six hundred years before the birth
of Christ, which the scholar was convinced proved the perpetual
virginity of Mary.  He had to do some fancy rationalizing to reach his
conclusions, because the passage itself is totally obscure."  Taking
from his pocket a small piece of paper he began: "I copied it, word for
word, from the real Bible, and I shall read it to you now," and he
bowed to Mrs.  Quade: "It all depends upon the word gate:

"Then the man brought me back to the outer gate, and it was shut.  The
Lord said to me, "This gate is to remain shut, It must not be opened;
no one may enter through it.  It is to remain shut because the Lord,
the God of Israel, has entered through it."  ' When none of the men
could figure out what this crucial text was saying, Jimenez continued:
"With full apologies to Reverend Quade for the word I must use, the
church fathers explained that the word gate meant the vagina of the
Virgin through which Jesus would enter the world, and through which no
other mortal would ever pass."  Raising his hands in a kind of triumph
as if he himself had solved this puzzle, he said: "In the passage
written about 600 B.C. Jesus is not identified, nor the Virgin Mary and
certainly not her private parts, but nine hundred years later the
Church was so eager to find proof of her perpetual virginity that they
accepted this strange interpretation of a text almost a thousand years
old."

Folding his paper with its quotation from Ezekiel Chapter 44,
verses one through three, he concluded: "It seems that drastic
measures, tortured interpretations, were required, but in the end a
great good was accomplished, delivering a noble portrait of a noble
woman to the peasants of the time, men and women like us, who
desperately wanted to believe."  Again he nodded toward Reverend Quade:
"And it was Helen's obstinacy that brought the truth to us."

From that moment on, the tertulia referred to the brilliant woman who
often ate with them as Helen.  She had established her own
credentials.

The widow Clay had finally decided to have a lumpectomy as planned, and
when the chemotherapy caused her hair to fall out, she also inherited
Mrs.  Mallory's expensive French wig, but when it came time to sort out
the various medical bills she found that her troubles were just
beginning.  The problem was that her various doctors and experts each
seemed to have his or her unique pattern of submitting bills, so that
she could never determine whether she should pay the doctor immediately
or wait till some governmental agency or private insurance company
would reimburse him or her for part of the bill, whereupon Mrs.  Clay
would be responsible for the remainder.

Of course she had Medicare plus minimal additional coverage from her
dead husband's company, but each of these organizations operated in
such mysterious ways that she never knew who owed what or who was to
pay for each procedure.  So she was harassed by eight different
agencies: five doctors, the hospital, Medicare, and private insurance
in a jungle so tangled and uncharted that in total frustration she
sought guidance from Dr.  Zorn.  He found he could answer almost none
of her questions and became so fascinated by this aspect of American
health services in day-to-day operations that he started to 'bird-dog
each of the steps."  Knowing that he was not well enough informed to
unravel the paper trail, he suggested to Mrs.  Clay that she consult
with Miss Foxworth, who had made herself the Palms expert in the
workings of

health-care bureaucracy.  The widow thanked him: "I graduated
from a good college, but on this I'm totally lost," and before she left
Zorn's office she showed him a threatening letter she had received that
morning.

It dealt with a visit to a local doctor's office, warning her that if
she did not pay the balance of her overdue account her case would be
put in the hands of a local bill collection agency with possible damage
to her credit rating: "Patrons have found that if delinquency is once
reported, it is a difficult matter to get it removed.  Please protect
your good reputation.  Pay this arrears now, and no action will be
taken.  You have two weeks to comply."

She explained to Zorn that her deceased husband, a meticulous
businessman, had always paid every bill presented to him by the doctor
in question and had been assured that the doctor's office would handle
the rest of the paperwork: "I've done the same, and now I get this
threat.  What can I do, my credit rating is important, because if a
widow loses it she has a difficult time getting it restored."

That's what Miss Foxworth is skilled at.  May I listen in on what
happens?  In my job I ought to know."

The conference was held in the accountant's crowded office, where she
kept a vast number of important addresses and phone numbers to help her
unravel the mysteries of American health care: "First let me get the
facts straight.  You were treated by five doctors?"

"Yes.  There are so many involved in treating a cancer patient.  And I
paid each one the part of his fee that he wanted.  His office staff
promised me they'd take care of the rest of the paperwork."

"You have your canceled checks proving payment?"

"I don't know.  I have their bills, which I marked "Paid in full" and
the date."

"Could you get the canceled checks?"

"I suppose so.  Yes."

"But some of the doctors have sent additional bills, the unpaid
balances, asking you to pay up?"

"Yes.  But they promised me Medicare would pay that.  Or my husband's
company insurance, Home Health of Minneapolis."

"And you paid your hospital bills?"

"Yes.  This long sheet of paper is the bill."

"How many days in the hospital?"

"Only seven.  I recuperated fast."

"So the total hospital bill, before any payments, was this figure?

$18,950?  Has the hospital threatened you?"

They demand that I pay, but they haven't made any threats."

"Have you spoken with anyone in the Florida Medicare office?"

"Several people, but I don't recall their names, since each time I
called I spoke with someone different."

"Let's see if we can get anywhere by starting with Florida Medicare."

Miss Foxworth dialed the 800 number and after listening to about ten
minutes of music, she finally got a clerk on the line.

"Good morning.

I'm calling on behalf of Clara Clay."

"Who are you?  Are you authorized to speak for her?"

"I'm the accountant for a Tampa retirement center, and Mrs.  Clay is
right beside me."

"Well, ma'am, my computer says that's impossible.  According to our
records, Clara Clay died several months ago-October 15."

"What!  She's very much alive, sitting right beside me as we talk."

"If you'll hold a moment, I'll get my supervisor."  And Nora had to
listen to another five minutes of cloying music until the supervisor
picked up the line.

"Yes, this is Mrs.  Kennedy.  Are you calling about Clarice Carpenter
Clay of Coral Gables?"

"No.  Mrs.  Clara Cunningham Clay of Tampa."

"Just a minute, let me check the name on the computer.  Well, I'll be
... When names are so nearly identical, errors do slip in.  Glad to
hear this Mrs.  Clay is still with us.  She's right there?  Please put
her on the line.  Welcome to the land of the living, Mrs.  Clay.  Was
your husband Dortmund Clay of Chicago?"

"No, Detwiler Clay of Indianapolis."

"And your Social Security number?"  When it matched the one in the
computer, Mrs.  Kennedy said brightly: "A deplorable mistake, but
understandable.  The computer here mixed up the files of the two Mrs.

Clays.  It will take us some time to sort out what bills and
information belong in which file, but when we do there'll be no further
embarrassment to you."

Getting Clara restored to life and her file in order required all
morning, but in the space between telephone calls Mrs.  Foxworth had an
opportunity to check the various bills and found them in order and

not excessively higher than normal.  They were from Dr.  David
Farquhar, the Palms' medical director; Dr.  Joel Mirliton, the
radiologist who did the mammography; Dr.  James Wilson, the surgeon
specializing in cancer operations; Dr.  Leon Jenner, the anesthetist;
Dr.  Ed Zumway, the administrator of the six-week radium treatment; and
the Good Shepherd Catholic Hospital, for seven days' stay.  The total
bill, including extras, was $27,080.

When Mrs.  Clay inspected the last bill, she shuddered, for she found
items like "Two aspirin $6.85; three gauze bandages $11.90; two Zantac
pills $15.50' and a flood of other charges of many dollars each for
items she could have purchased herself for pennies.  But when she
complained, Miss Foxworth said: "Hospitals have to stay open so that
when you need them, they're there.  What they charge for any one item
doesn't really count.  They have to make the bill big enough to stay in
business."

"You think the bills, overall, are reasonable?"

"They're what we see all the time.  If you'd had something that
required six months in the hospital, eleven different doctors, total
charges of upwards of a hundred thousand dollars.  Then you would
really sweat."

"All right.  I agree that my bills are trivial by comparison.  But how
do I find my way out of this jungle of who pays for what?  And how can
I avoid having the collection agency destroy my credit because I didn't
pay some bill I never knew about?"

"Mrs.  Clay, remember this.  Your case is not exceptional.  Nobody has
gone out of his way to do you harm.  It's the system, especially the
paperwork system.  To tell you the truth, Mrs.  Clay, you're one lucky
woman!  Dead one moment, alive and kicking the next."  Her final words
were even more comforting: "The good thing about all this is that once
Medicare gets this case of mistaken identity straightened out, you may
owe next to nothing.  We'll just have to wait until we hear, then if
you still owe a little, you'll pay up and not have to worry about it
again."

When the widow left the accounting office, Dr.  Zorn asked: "Was her
case typical?"  and Miss Foxworth used her left thumb to indicate the
hundred and eighty-two residents in Gateways: "Each one has his or her
own special problems with health costs.  So much paperwork, so many
different systems, so much of what you might call "planned

chaos," that I'm surprised anyone can keep his or her head above
water."

"Your own records?  Can you keep them straight?"

She gave a mirthless laugh, reached in her top drawer and pulled out
two letters warning her that unless she paid the delinquent bills they
would be turned over to a collection agency: "I'm the local expert and
I can't understand my own accounts!"

The four men who constituted the tertulia were judged by the other
residents to be the brains of Gateways, and the corner in which they
met was viewed with awe and a touch of pride.  They were presumed to be
of such high intelligence that common folk could not really converse
with them, and when word did leak out about what they had been
discussing of an evening, people were apt to say something like "What
else would you expect of those brains?"

These assumptions of superior intelligence were fortified at the bridge
table, where Senator Raborn and Ambassador St.  Pres were so adroit in
bidding and play that they were not allowed to be partners.

As Ms.  Oliphant complained: "You simply cannot follow their bidding.

You and your partner have ten clubs, but they open the bidding with two
clubs, no way they could make it.  Then they bid spades and diamonds
and in the end one of them says four hearts and that's what they
intended from the first, because partner jumps to six, and they make a
slam."  The two experts explained several times that they used a
variation of the Italian system and even wrote down what their various
bids meant for all to see: that two diamonds showed heart strength and
so on.  During play they allowed their explanation to rest on the
table, and when they made an esoteric cue bid they would point to the
line on the card that explained what it signified, but still they won,
so their partnership had to be outlawed.

Intellectual and bridge prowess aside, the men of the tertulia were
remarkable for another reason-their age.  One of them, Senator Raborn,
was in his eighties; two of them, Ambassador St.  Pres and President
Armitage, in their late seventies; and one, editor Jimenez,

had just turned seventy-one.  They were about to demonstrate that
even at their advanced years they enjoyed abilities and dreams no one
could have imagined.

The adventure started one night after dinner when St.  Pres said: The
four of us ought to be engaged in a lot more than abstract
philosophizing.

We have the talents to attempt some big effort," and the other three
showed immediate interest.  There was protracted discussion about what
might be a practical project, and even after waiters cleared their
table they remained huddled, discussing and rejecting proposals such as
starting a class in a nearby junior college to be given some modest
title like 'the wisdom of the world," or the formation of a civics club
that would teach high school students the true meaning of democracy.

"No," the ambassador said, 'we're still spinning our wheels, still
verbalizing.  I intended something we could do with our hands."  When
they pressed him for an example, he gave one that was so bizarre, so
totally beyond normal reasoning, that at first the other three rejected
it, but the more they talked and revealed hidden aptitudes, the more
practical St.  Pres's suggestion became until, sometime after eleven
that night, the four men agreed upon what would be a gallant effort,
preposterous perhaps, but one that would challenge and demand their
full energies.

The program started early next morning when Senator Raborn, a man who
knew how to get things done, called on Ken Krenek with a publicity
brochure distributed by the Palms some years before: "It says here in
bold type that when functioning, the Palms will offer women comfortable
nooks for teas and socials and bridge, and their husbands, and I quote:
"a fully equipped hobby shop with hand tools and a lathe."  I represent
a committee asking that this promised amenity be provided.  Now."

Krenek knew from reports assembled when the senator and his wife
applied for admission to the Palms that Raborn had been famous in the
Senate for using his seniority and personal power to bring ever larger
infusions of federal money into his state.  One cynic pointed out that
if his state got any more government installations it would sink, and
Raborn himself had once observed that 'people in the big cities can
laugh at us rubes out in the sticks, but their taxes go to support our
operations."  So Krenek knew the odds were that Raborn would get his
workshop.

Ken first called Miss Foxworth to see if there was any budget provision
for such a room and she could recall none.  He then discussed the
problem with Andy, who capitulated to the inevitable: "You say we
printed it in one of our early brochures?  We did?  Then, I guess we
have to see to it that it's done.  A wood lathe can't cost a fortune.
Get one."

When Krenek asked where they were going to find a room, Andy reminded
him that there were still vacant one-room apartments on the first floor
of Gateways.  Krenek went back to Miss Foxworth to determine where they
could tuck in a workshop, and she pointed out that they'd had trouble
disposing of one of the ground-floor rooms that opened directly onto a
parking lot, and the decision was made to use it.

The Palms was generous in providing not only the lathe but also the
hand tools that would normally go with it, and the four tertulia
members were equally helpful in donating their own equipment to the
common effort, so that soon the new workroom was humming night after
night behind a door that was never opened to the other residents.
Rumors circulated about what might be going on inside, but not even the
two wives, Marcia Raborn and Felicita Jimenez knew what their husbands
were doing there.  What was obvious was that it involved wood, lots of
high-powered epoxy glue, and bits of canvas, but this information did
not explain the mystery.

Then one day Felicita Jimenez, in opening her husband's mail as she was
accustomed to do, found a well-illustrated catalog for 'men who were
building their own airplanes."  It offered a wide variety of items for
the enthusiastic amateur to purchase, with diagrams of how the
components would be fitted together.

"My God!"  she cried in disbelief.

"Are those idiots trying to build an airplane?"  Aghast, she ran
downstairs to consult with Mrs.  Raborn, and when the senator's wife
saw the catalog, she and Felicita marched to Raborn and demanded that
they be allowed to see what was happening in the new workroom.

Reluctantly he agreed and opened the sawdust-covered room.  The sight
that confronted them struck the women with terror.

The four men were indeed building an airplane.  Starting with a kit
that provided much of the intricate innards, they were adding the
canvas, the struts, the fuselage.  Even more appalling to the two
women, who knew something about the difficulty of putting together even
the parts of a dress, was that the men were actually trying to build

the wooden propeller.  Since it was to be a single-engine plane, the
efficiency and durability of the propeller was crucial, yet there they
were, cutting the pieces of some exotic wood, which, when laminated and
shaped, would be the element that would keep the plane aloft, assuming
it ever left the ground in the first place.

When word flashed through the Palms that the resident geniuses were
building a plane that they intended to fly, discussion centered first
on the expertise of the four participants: "Ambassador St.  Pres told
me that while serving in one of the new African republics he learned to
fly the embassy's one-engine plane, in case he might have to evacuate
in a hurry," and someone else noted that President Armitage had been
good at science and had once taught a seminar on the properties of
various metals and woods.  Raul Jimenez was skilled at amateur
woodworking, having built various small items to enhance their
apartment, and Senator Raborn was knowledgeable about gasoline powered
engines, having taken apart and reassembled automobile power trains
since he was a boy of eleven.

It was agreed that the four men had the ability to bring together the
various parts of a small airplane, but it was obvious that they could
not build an engine that would fly it, nor were they having much
success in constructing the propeller.  The engine's no problem," St.
Pres assured those who asked.

"The Lycoming people in Pennsylvania have been building great engines
for half a century.  They've said they'd sell us one and send
instructions on how to install it.  Raborn says he'll know how to
attach the controls and see that it's properly fitted to the
propeller."  The men spoke with such confidence that even those who had
at first doubted their engineering skills finally had to concede that
it might be done.

Their optimism was strengthened when the original four took in a fifth
partner, Maxim Lewandowski, eighty-six years old but a firstclass
scientist with proficiency in varied fields; he would assume
responsibility for fashioning the propeller, determining the various
angles and taking charge of the laminating that would bind different
woods into an indestructible bond.  To watch him hard at work with the
lathe, the pot of epoxy and his shaping tools was to see an old man
reborn and revitalized.  He became the intellectual core of the
operation, just as St.  Pres with his firm insistence that the job
could be done

and that their energies would produce a plane that could fly, had
provided the moral force.

When residents asked: "Who will fly it if you do get it finished?"
St.

Pres said with icy confidence: "Any one of the four of us could do
it.

After all, it's like driving an automobile in the air."

"Yes, but who will take it up the first time?"  and he said: "I will. I
flew in Africa.  It's nothing, really, if you have a stout plane and a
reliable engine."

As the venture slowly progressed with various components nearing
completion, it enthralled the residents, who were allowed to look into
the workshop at announced intervals.  Their repeated question "How are
you going to get this huge thing out of this little room?"  was easily
answered: "We take out that window and drag it out with a small
lawnmower motor-and our muscle power."

"Yes, but what do you do about those big wings standing in the
corner?"

"We attach them when we get outside."

"But we don't see any motor."

"In an airplane it's an engine.  That's due to arrive in several
months.

We fit it in, turn it over, check to see we have enough gasoline and
oil, and fly away."

"Where will that take place?"  they asked and the men showed where, in
a relatively flat place in the savanna, they had employed a man with a
power mower to clean a narrow strip that could be used for takeoffs and
landings.  Seeing this field, the residents were satisfied that their
five wizards really did intend to fly their contraption.  A thrill of
pride spread throughout the Palms; their men, all of them past seventy
and one nearing ninety, were going to build and fly an airplane!  It
gave everyone a boost in morale, especially those in Assisted Living
who had generally felt that their hospitalization was probably the
beginning of the end.

"Hell," one man recovering from a hip operation grumbled, 'they're all
of them older than me.  If they can do a crazy thing like that, what
might I do at only sixty-two?"

But the effect on the third floor, Extended Care, was even stronger.

The sensible people who knew they were close to death went to their
windows to watch the mower clearing the space in the savanna and

applauded: "I hope they make it!  More power to them!"  and the
elderly team with their flying machine became the symbol of the entire
Palms complex, an affirmation of the life force.  People immured on
floor three prayed that the airplane would soon be finished so that
they could see it fly, triumphant in the heavens, before they died.

Eleven years earlier, when the Taggart Organization in Chicago had
appointed Ken Krenek to be the number two man at the Palms, it had not
been their intention that he should also serve as the person
responsible for the social entertainment of the guests in Gateways.

But he showed such a remarkable talent for keeping people active and
happy, that without ever having been assigned to the task, he found
himself making the decisions.

"I had a vision of elderly people wasting their hours here in boredom
and decline," he explained to Mr.  Taggart, 'and I thought that a
shame.  A waste of human capacity.

These people still had years of fine living ahead of them, they could
make real contributions.  And best of all, it would cost us only
pennies to help them."

When Taggart asked how this would strengthen the Palms, Krenek said:
"They'll enjoy themselves, feel younger, remain active, and when
prospective clients come for exploratory visits our residents will
become our salesmen.  They'll say: "We have a great time here.

Something happens every day."  And the visitors will see retirement as
much different from what they had been fearing.  You watch!  We'll sign
up the undecideds."

So, given a free rein, Krenek had developed a schedule that would have
been appropriate for a summer camp for fifteen-year-olds.  On Mondays,
Wednesdays and Fridays the private bus belonging to the Palms started
at nine in the morning for a tour of four big shopping centers in
different parts of Tampa.  Residents who got off at the first stop at
nine-fifteen were allowed two hours of shopping and exploring; at
eleven-fifteen sharp the bus came back to pick them up along with their
sometimes bulky packages.  At nine-thirty, with pickup at eleven
thirty, the shoppers were dropped off at the second mall, and so on
through the third and fourth stops.

Tuesdays the bus was reserved for a rich variety of field trips, to
places like zoos, flower gardens, nature trails, lakes and the starting
points for one- or two- or three-mile hikes through interesting
countryside, with the bus waiting when the hike ended.

Thursdays were reserved for trips to cultural activities, and here
Krenek displayed his extraordinary inventiveness, for he had searched
out little theater groups, musical ensembles, university courses in the
arts and the various art museums in Tampa, nearby St.

Petersburg and Sarasota.  Besides the Dali Museum and the Ringling
Brothers and Barnum and Bailey circus history museum, one of the most
appreciated excursions was the one to a series of bookstores in the
region.  At every such visit the Palms awarded one free copy of a
desirable book-a popular novel, a book on Florida birds or a splendid
selection of historic maps in color-to a member of the tour selected by
lot.

On Saturdays there was a special tour.  At eight in the morning the bus
left to take the residents who had made reservations to a well regarded
restaurant that served a bountiful breakfast at nine-thirty for a flat
fee of $7.50 and was worth, many said afterward, 'at least fifteen
bucks in New York or Chicago."  Sometimes Krenek would hire a local
guitarist or a duo to provide music to accompany the meal, in which
case the party might last as long as a couple of hours.  Rarely was
anyone disappointed in these breakfast forays; one stout fellow in his
seventies announced loudly: "All my life I heard about southern grits.
I thought they were a Dixie version of oatmeal, God forbid.  But that
custard of grits, cheese and bacon bits-angels must have been sent down
to bake that dish."

On Sundays the bus started at seven with trips to Catholic churches for
early Mass, and was kept busy till two in the afternoon hauling
residents to various churches and bringing them back home for the gala
Sunday-noon dinner, at which women were supposed to put aside their
weekday trousers and shorts and appear in a dress, while their husbands
were expected to wear a jacket and tie.  A normal week at the Palms
could not be boring unless one insisted on making it so because, in
addition to the daily tours, Mr.  Krenek also

provided at the east and west ends of each floor in Gateways
quiet nooks for bridge games, plus a pool table in the recreation room,
a library with thousands of books that had been left behind by
departing guests, and two top-rated motion pictures on Tuesday and
Thursday nights.  Quite often, on Sunday evening when no meals were
served in the dining room, musical groups from nearby colleges
performed or devotional services were conducted by local clergymen,
perhaps with their church choirs.

One resident summed it up accurately: "It's the mirror image of
childhood.  In those days people served as older teachers, showing us
how to learn and amuse ourselves.  Today young people instruct us
oldsters how we can educate and entertain ourselves.  Either way, it's
a good system."

Andy was so appreciative of the contribution that Krenek made with his
program that he asked him: "How did you ever become a professional in a
field like entertainment?  You don't seem the type, and nothing in your
record would indicate it."

Krenek gave an involved explanation:

"My parents hadn't much money, but they loved to take cultural
expeditions and vacations that meant something.  They were masters of
the free museum, the inexpensive weekend.  They happened to patronize a
Jewish bakery operated by a wonderful fellow named Levy, and he told
Pop: "The places that give you the most for your money are the big
Jewish resort hotels in the Catskills.  Grossinger's, the Concord, and
a tremendous value, the Beersheba.  You catch a bus, it takes you right
into the mountains Friday afternoon and brings you back early Monday
morning.  Best vacation dollar in America."

"So the Kreneks became Jews, said we were from Lithuania, and we began
frequenting Grossinger's and the Concord.  But my father was always
looking for the bottom dollar, and we wound up at the Beersheba,
smaller, friendlier and with a much better pastry cook.  I was very
happy at the Beersheba until my father saw that I was falling in love
with a Jewish girl.  We stopped being Jewish and became standard
Germans again.  No more delicious pastry.

"But there was a young man at the Beersheba who made a lasting
impression on me, Izzy Korngold, everybody called him Izzy Korn.  He
was a tummler."

"A what?"

Tummler, spelled with a " but pronounced toomler, and he was one of the
best, definitely on his way to the top of his class.  Under a different
name he became a standard Borscht Belt comedian, and a good one."

"What were his talents?"

"His job was to keep the guests tummled, entertained but in a very
active way.  Games, crazy dances, singing.  He was a master at Simon
Sez, in which he'd have everybody up and down and wagging their ears,
and hopping on one leg.  I was crazy about him, he seemed to make
everybody happy, and I began to follow him around, asking how he did
his tricks, what his secrets were, and he was very patient.

He told me: "The secret, Kenny, is that people are lonely.  They want
friends.  They want to talk with their neighbors, and laugh and cut up.
But by themselves they simply cannot do it.  Believe me, Kenny, you
could have the Louvre Museum, that's in Paris, right over here and
they'd never go see it unless I led them, and joked with them, and told
them how much fun it's going to be, something they'll never forget."

"I remembered what he told me, and in college I helped the non
fraternity kids discover things to do and how to make friends.  It came
naturally to me, and when I came here it was simple to pick up where
I'd left off with Izzy Korn.  A Jewish widow in Gateways, she's dead
now, bless her, told me one day: "Mr.  Krenek, you must be Jewish.

You're a perfect tummler," and when I told her I'd learned how at the
Beersheba, she embraced me, wouldn't let me go.

"The Beersheba!"

she cried, "Herman and I went there for years, but we never met this
Izzy Korn," and I told her: "He came later.  He was very young when I
met him but already very good."  And that's how I learned to help
people have a good time-and a good life."

Three times each year two buses were required for what had become not
only a tradition but also one of the most unusual and instructive tours
on the west coast of Florida.  On these days Judge Lincoln Noble
conducted a tour to a remarkable place, unlike anything the residents
had ever known, which he had discovered some miles south of Tampa.

Krenek was eager for Andy to see this miracle, so when the next tour
came round in April they were both seated in the front bus beside the
judge and listened attentively when Noble spoke to him about the

origin of the miracle they were going to see: A paraplegic
veteran from Vietnam named Tom Scott had come home in a wheelchair, and
to give him something constructive to do his uncles bought him a little
plot of land right on the Gulf of Mexico, about as big as a tennis
court, no more, but with a sandy beach that extended north and south to
touch and include the beaches in front of two expensive condominiums.

"There this enterprising young man with his wife-she'd been his nurse
in Vietnam-achieved an amazing feat: they lured to their beach a
collection of hungry pelicans, among which were several that had been
crippled by being hit by motorboats or entangled in fishing lines,
especially the invisible filaments that never rot or disintegrate. Such
birds are doomed unless some human being untangles them, and even then
many remain crippled.

"The young man, Tom Scott, prevailed upon his uncles to build him,
inland from the beach and crammed into a tight space, a sanctuary for
birds, pelicans principally, and there in wire cages the birds
prospered.

As the cripples recovered, but not enough to resume flight in the wild,
they began to live their natural lives, building nests, having babies
and showing inquisitive visitors how pelicans live.  You're going to
have a marvelous peek into nature's secrets today."

"How did you find the place?"  a woman asked and the judge explained:
"As you've probably seen, I've pretty well tamed a big pelican at the
Palms.  One morning he brought with him a bird that was hopelessly
tangled in fisherman's filament, bound to die unless someone unwound
him.  I couldn't tempt the doomed one to come ashore, but a workman who
saw my futile attempts ran up and told me: "There's a man south of here
who takes care of birds like that."

The telephone operator was able to locate him, and up he came in his
special Ford pickup truck-he's a paraplegic but his car has special
controls-and he and his helper were able to lure our cripple and take
him back to the refuge.  When I drove south to visit my bird I
discovered this miraculous place, and we've been going back ever
since."

"What is the miracle?"  the woman asked, and he said: "They're at least
a dozen of them, but there's one, I am sure, will blow your mind, as my
grandson says."

Andy asked: "What is this super miracle  and Noble laughed: "No,

you've got to wait, too," and the two buses continued their way
south to a spot right in the midst of a cluster of typical Florida
condominiums.

Andy, looking at the place, told Noble: "You wouldn't expect nature to
have a foothold here," and the judge agreed: "That's what I thought
when I first saw it."

When the buses had disgorged some sixty people, the judge led them to
an inconspicuous passageway between tall buildings that opened onto a
wonderland.  In a space not much larger than a tennis court, Tom Scott
and his wife had utilized every square inch to provide pens for various
kinds of wounded birds, a rather big central cage filled with pelicans,
an office building, benches for visitors, and a walkway down to the
beach with the Gulf of Mexico smiling beyond.  Rarely had land been so
constructively and ingeniously used.

Scott, in his motorized wheelchair, was the most energetic person in
the crowd, darting everywhere and delivering a lecture about his
establishment: These are the older birds who have mated and reared
their young.  The parents will stay here for the rest of their lives,
no way they could survive out there," and he pointed to the gulf.

"But their chicks, like those noisy ones over there, we'll be setting
them free before long.  They can fend for themselves."  And everywhere
he moved, everything he explained, focused on the pelican, that amazing
big bird with the stubby body and the extraordinary head and beak: "He
was summed up perfectly by an American poet in a famous verse, which
I'll recite.  Ten dollars to anyone who can name the author:

"A wonderful bird is the pelican, His bill will hold more than his
belican.

He can take in his beak Enough for a week, But I'm damned if I see how
the helican."  ' When no one could identify the poet, Scott said
triumphantly:

"Dixon Lanier Merritt, and no one has ever been able to tell me who he
was.  If you can find out, write to me."

When his visitors had studied the ungainly birds close up, he invited
them to join him in a crowded office containing a big white cotton
screen on which he showed a film clip of pelicans diving into the water
to catch fish.  The cormorant is known as the world's premier fisher 4
9 man among birds," Scott said as the lights were lowered, 'but bird
for bird, the pelican catches far more fish.  Let's watch how he does
it.

First, at normal speed.  See, he comes in just as you and I would if we
had wings.  Belly parallel to the water, head pointed down so that the
eyes can patrol the waters below, then a bend forward into a diving
posture, and with all parts of the body under control, a headfirst dive
into the water."  He ran the film again showing an apparently routine
dive: "But wait!  Did you catch what looked like a blur right at the
end?

Let's take another look at that," and with the film running in very
slow motion Andy and the others witnessed a maneuver they could not
believe.  About two feet off the water, at the end of a powerful flight
and with his prodigious beak about to smash into the waves to spear the
target fish, the pelican turned over on his back so that he could dive
down into the water upside down.

"Yes," Scott said as he showed the slow motion three more times, 'this
amazing bird, big and clumsy on land, can flip completely over at the
most powerful point of his flight and hit the water upside down."

"Why does he do it?"

"We've speculated and found no explanation.  I believe it's so that his
eyes, in this critical final second when seeing beneath the water is
all-important, can have an unobstructed view.  But you've seen for
yourselves.  He really does turn upside down at eighty miles an
hour."

"Has that speed been checked?  By radar gun?"

"I'm just guessing.  It looks like eighty, could be forty.  But for a
bird that size it's awesome."

The woman who had asked questions on the bus directed the next query
not to Scott but to Judge Noble: "Is this the miracle you told us
about?"  and he answered: "No, it's much bigger."  Scott called to his
wife: "Gloria, let's move the feeding up a bit so we can take our
visitors out now."  When his wife appeared with a huge canvas shopping
bag over her left shoulder, Scott himself led the way down a boardwalk
that had been specially constructed for his mechanical chair, and the
group went down to the white-sand beach.

When they arrived there, they saw two or three birds pecking at
invisible goodies, but within fifteen seconds of the arrival of the big
shopping bag, visible to birds for miles, the pelicans began to stream
in, scores of healthy creatures flapping their big wings and landing in
a cloud of sand close to the intruders.  Before the first morsel of
fish

could be thrown out by Mrs.  Scott, more than a hundred noisy
pelicans had arrived, darkening the white sands and attracting
observers in the surrounding condominiums.

When Mrs.  Scott started throwing out bits offish, two male helpers
from the sanctuary did the same from less conspicuous containers, and
soon the beach in front of the sanctuary was covered with birds while
the sands in front of the condominiums were also well populated.  Scott
said: "Experts have tried to count a flock like this.  They come up
with something like a hundred and fifty pelicans, two hundred gulls."

Suddenly he cried to the two helpers: "Over there!  The one with the
broken wing."  The men threw down their feeding bags and dashed into
the midst of the birds, focusing on a crippled bird who could not
escape capture.  Bringing him back to the spectators, they showed how
some accident had broken the pelican's left wing so badly that flight
was impossible.

"He's one for the pens," Scott said.

"The vets may be able to mend that one, but I doubt it."

One of the Palms people, an elderly woman named Mrs.  Goldbaum, asked
in a whisper: "Mr.  Scott, this is truly a wonder.  Would I be allowed
to move out among the birds?  I might never again have a chance like
this."  He motioned to his wife: "Gloria, please take her out," and the
two women, one so young and fresh, the other so old and wasted, moved
slowly out into the middle of the pelicans.  The birds edged away, of
course, but not to any great distance, and when Mrs.

Scott signaled for one of the helpers to fetch a stool, old Mrs.

Goldbaum sat in the middle of a hundred pelicans, luring the birds to
her with a few bits of fish until the bolder ones were eating from her
fingertips.

For fifteen minutes or more she remained on her stool, conversing with
her pelicans.  When she finally signaled that she was ready to leave,
the birds followed her back to the others.

On the ride home she sat next to Dr.  Zorn and said: "One day like this
is worth all the years we struggle to reach it, all the medicines, the
operations, the nights without hope.  Such a day, a hundred big birds
coming to visit with you and eating from your fingers without biting
you.  I'm so glad you arranged this."

That night, at about three in the morning, the signal bell at the
watchman's desk in Reception was activated, meaning that some resident
was in trouble.  Checking the source, the watchman found that it

was Mrs.  Goldbaum, who lived alone in a spacious apartment on
the third floor.  Her door had been left unlocked, and when he rushed
in he saw Mrs.  Goldbaum, dressed in her sleeping gown, lying dead on
the floor.  It looked as if she had suspected the approach of death
and, after signaling for help, had unlatched the door so it would not
have to be broken down to find her.

When Andy was summoned he found Scotch-taped to the inside of the door
a check for ten thousand dollars made out to the Pelican Sanctuary and
signed in a wavering hand "Rita Goldbaum."

It was a paradox.  One of the major reasons why couples moved into the
Palms was to escape the tyranny of their adult children and the
noisiness of their grandchildren.  But the warmest and most rewarding
days of the month came when some family with numerous grandchildren
appeared for an informal reunion, and the chatter and laughter of
children could again be heard.  Then a sense of life throbbed through
the place and the older people were reminded of what the grand march of
life was: this endless cycle of the old growing older and their orderly
replacement by the young.  Such days gave the residents special joy.

Raul Jimenez said: The sound of children laughing is the echo of
civilization," but his wife, Felicita, added: "And the wonderful part
is that after dinner they go home."

One couple had three charming granddaughters under the age of ten, and
when they appeared with their two mothers, who looked like cover girls
in their thirties, they were a quintet of beauties, with their lovely
complexions and graceful manners.  The residents enjoyed it when they
visited, and some of the other grandmothers liked to stop by their
table at dinner and compliment the little girls.

"We wish you could be with us always," some of the women said, but the
girls' mothers, knowing what hellions their girls could be at home,
replied:

"We're not sure you'd like it on a daily basis," and the girls'
grandmother, though she doted on them, had to agree.

Less pleasant was the visit of a man in his late forties.  Lester Chubb
was not married, at least not now, had no children of his own, and it

was difficult to determine what he worked at, if he had a job at
all.  He came from Iowa to visit his widowed mother, and each
appearance was something of a trial to both mother and son.  It was
believed by those who watched him that he visited only to keep in the
good graces of his mother, who controlled the purse strings of the
family.  When Chubb was asked what he did, a question put to almost
everyone at the Palms, he said that he looked after his mother's
interests, but she had already made it clear to friends that she had no
financial interests in Iowa, that they were in the hands of a bank her
husband had used in Chicago.

When, during one visit, Lester suggested rather strongly that his
mother shift her account to an Iowa bank, she consulted with Senator
Raborn, whom she regarded as a trustworthy conservative: "One of my
fears is that Lester-a fine boy, I'm proud of him-has never been good
at handling his own accounts.  Why would he do better with mine?"

When Raborn looked into the situation and asked a gentleman on the
Senate banking committee to check into the two banks involved, his
friend told him: "On a scale of one hundred, Chicago is about
ninety-two, Iowa down around thirty-one," and he advised Mrs.

Chubb to keep her money where it was.  But after that rebuff, Lester
did not come to visit anymore.  His mother, fearing that her refusal
had offended him, tried to appease him but he continued to sulk in Iowa
and stayed away for an entire year.

It was a different story when the four Lewandowski children and their
spouses and children descended on the Palms.  The two sons and their
wives and the two daughters with their husbands, all in middle age,
presented a portrait of America at its best.  One son was a full
professor at Caltech; his brother, CEO of a major industrial company.

One of the daughters was a professor at Wisconsin; the other, vice
president of a computer firm.  The spouses also had equally impressive
careers, and all eight served on the boards of various educational,
cultural and community political organizations.  The four couples had
nine children among them, making a total of nineteen family members
when all the Lewandowskis gathered for a reunion with Maxim and Hilga.
No one at the Palms was surprised that the children's behavior was
exemplary.

There were other families whose children and grandchildren were
pleasant to have around and whose presence enhanced the Palms in

various ways, especially the Grigsby children, three of whom
played musical instruments and gave informal concerts when they
visited.

All in all, children and grandchildren, whether exceptional or not,
were equally appreciated, even if they did remind residents of their
own mortality.

"We'll be gone," Felicita Jimenez said one evening after her family of
six had departed, 'but the Palms will still be here, and other
grandchildren will be visiting.  It's quite reassuring, when you think
of it."

When a daughter of one couple at the Palms was killed along with her
husband in a helicopter crash, their three teenage children were taken
in by their grandparents for temporary shelter.  They were so endearing
that several residents asked Mr.  Krenek: "Why can't they remain here
during the rest of the school year?"  but he wisely said:

"We're not geared for that kind of occupancy, not even for the
Garbers."

The visiting of young people was therapeutic for the older residents,
for it prevented them from focusing entirely on themselves, but not all
the visits were salutary.  During the spring the children of the
dancing Mallorys visited the Palms twice, the son and his wife, the
daughter and her husband, accompanied by their children in their
twenties and thirties.  Their visits were curious, for when they were
at the table with the elder Mallorys they ate in almost total silence
or conversed only in grunts, but when they were with other residents
and their parents were not present, they asked probing questions about
the elder Mallorys.

Enough comments were made about this odd behavior that Ken Krenek went
to Dr.  Zorn with his fears: "Andy, I've watched that Mallory brood and
what I see I do not like."

"What are they up to?"

"I'm not sure.  I'm judging only from the fact that they're an ugly
gang, those children, and they do not wish the old folks well."

"Ken, we don't deal in vague suspicions around here.  Anything
specific?"

"I work on the averages.  They resemble some others I've watched.

Believe me, they mean our Mallorys no good.  Keep an eye on them."

Thus alerted, Zorn did watch the Mallory brood and the more he saw of
them on that first visit, the more he distrusted them.  On their second
visit they continued ignoring their parents while visiting various
businesses in Tampa.  What business dealings the group was involved
with, Zorn could not ascertain, but when they left Florida, Andy went
to Krenek: "Ken, I'm satisfied you guessed right on those creeps. But
the mystery remains.  How could two people as delightful as the
Mallorys produce children and grandchildren who seem to be such perfect
boors?"

They're worse than boors, Andy.  That crowd is evil.  You can see it in
their eyes.  You and I ought to warn the Mallorys.  They'll defend
them, of course, but we might get some clues."

Zorn did not relish prying into residents' affairs, but Krenek was so
disturbed that against his better judgment he allowed the interview to
occur.  It took place on the veranda overlooking the pool, and at first
Mr.  Mallory acted as if he did not know what the administrators were
hinting at.  All he would admit was that the children did not like the
Palms and felt that their parents were being cheated financially, but
from time to time Mrs.  Mallory did indicate that she could understand
why Krenek was asking these discomfiting questions.

The children have never been close to their father," she said at one
point, much to her husband's irritation.  They seem to resent him, and
they certainly don't like me at all.  It's as if they think I come
between them and their father.  Under the circumstances I certainly
do."

"Esther!  They're your children, too."

"Yes, and I'm not proud of them.  They have none of our joy of life.

They grew up to be, God alone knows how, mean-spirited people, and I'd
be content if they stopped visiting us.  They bring no joy."

Mr.  Mallory stared at his wife, unable to believe that she had spoken
so frankly to strangers, but when he started to rebuke her, she said:
"I think of Dr.  Andy and Mr.  Krenek as my children much more than I
do those others.  You're the ones, you two, who give me comfort and
consolation these days, and it grieves me to say so."

When the conversation ended, with the administrators having learned
nothing substantial about the Mallory children, Krenek accompanied Zorn
back to the latter's office: "Andy, what she said there at the end-you
and I are her children-she looks to us for supportI've seen this happen
before.  We're here.  We're available.  We can make things easier for
them if they run into trouble.  It's a dangerous development, so
please, don't either of us do anything to increase that kind of
identification with us.  The children could develop a real complaint

against us and move their parents out, even charge us with
exerting undue pressure."

"That sounds improbable."

"Damn it all, we had two cases with the former administrator.  Heart as
big as a pumpkin, he listened to every complaint and did side with the
old folks against their children.  When they died-the old folks, that
is the kids found their parents had left him something in their will,
and they went to court and had it upset.  A messy affair, but it did
look as if he'd exercised undue influence at the end."

"You're a very suspicious guy, Krenek."

"No.  It's just that I have a very sensitive nose for garbage."

The week after the second Mallory intrusion, the Palms had a much
different kind of visitor, who restored confidence in relationships
between the generations.  Laura Oliphant's niece, Mildred Oliphant,
aged forty and unmarried like her aunt, flew down for a three-day
vacation at Laura's insistence.  Despite the difference in their ages,
the two women looked alike: medium height, sharp-featured, aggressive
but loath to speak unless vitally interested in the problem at hand.
The younger Ms.  Oliphant worked as a computer expert on the staff at
Duke University Press and was helping move that distinguished outfit
from old-style publishing into the new electronic systems.

When Dr.  Zorn and Krenek dined with the two women, the younger Ms.
Oliphant spoke at length and with considerable ardor about how her aunt
had taken her in when she was orphaned, seen her through puberty and
high school, and sent her on to college: "If there is a living saint,
it's this woman sitting here.  What a difficult time she had with me. I
hated the world.  Felt that my mother's death was a personal affront to
me.  Despised my teachers when they wanted to help me.

Aunt Laura, no wonder you turned gray prematurely."

After the younger woman's long explanation of how they survived,
emotionally and financially, Laura finally spoke: "In the middle of the
Sturm and Drang when I was feeling sorry for myself a thought flashed
through my mind: "The job of parents is not to browbeat a child into
the kind of adult they would prefer, but to give the rebellious one all
the love in the world and the encouragement to become the kind of
productive human being the child aspires to become."  Later, I phrased
it more simply: "It isn't Mildred's obligation to make me happy. It's

her job to make herself productive, in whatever that might be."
She smiled at Mildred, reached out and clasped her hand and said:
"After that it was easy, for all I did was allow her to become a
wonderful, mature, emotionally free human being."

The following night the residents were assembled after dinner to hear
Mildred give a forty-minute talk on how Duke University was now
publishing its books, and almost every step in the new processes she
described astonished her listeners, including Zorn and Krenek.  She was
an excellent speaker as she explained the miracles of desktop
publishing in which the word processor made obsolete a half-dozen
cumbersome machines.

As they left the session, Krenek asked Zorn: "Wasn't she fascinating?

She presented her ideas so clearly and interestingly."  He added:
"Wasn't she a nice change after those horrible Mallory kids?"

And then a cloud momentarily dulled the shining impression the young
Ms.  Oliphant had made.  The Duchess received a letter from a friend on
the faculty at Duke that contained startling news:

I understand that Mildred Oliphant, one of the stars at Duke, spent
some time with her aunt at your establishment.  She's notable here for
having been the first unmarried woman to bear a child out of wedlock.
She not only kept the little girl and reared her with no outside help,
but proceeded rather promptly to have a little boy by the same process
but not necessarily the same father.  It raised an enormous stink, but
that was at the beginning of the drive for women's equality, and Duke
was afraid to fire her, because of lawsuits and possible campus
marches.

But even hurricanes quiet down after the big blow, and the same
happened here.  If you take the North Carolina triangle of Duke, North
Carolina, and N.C. State, I suspect you'd be able to find several cases
of faculty women who are unconventional mothers and nobody worries
about it anymore.

When this news circulated through Gateways, women who had met Mildred
could scarcely believe it, for they remembered her as such a congenial
person that rumors of her sexual rebellion were hard to

credit.  Some months later the elder Ms.  Oliphant not only
invited Mildred to return to the Palms but asked her to bring along her
daughter and son.  The girl, a scholarship student studying French at
Princeton, and her younger brother, a football player at Wesleyan, were
so well mannered and such charming conversationalists when they visited
with the other residents during their three-day stay that any
objections the gossips might have had regarding their mother were
completely withdrawn.

The Duchess, who knew class when she saw it, and who was pleased that
the young woman was studying French, broke her habit of avoiding the
dining room at night and preempted two tables for a small dinner party
featuring the two young scholars.  She brought two bottles of a good
French wine from her private stock and offered a toast in a voice so
loud the nearby tables could hear it: "Autres temps, autres moeurs!"

To the man at her right she whispered: "If the peasants don't know what
that means, they're the losers."

The visits of children to the Palms continued to pay dividends for two
reasons, as Jimenez pointed out: "When you're past seventy, you need
children around now and then to remind you of what the continuity of
life is, and also, in these days, you never know what refreshingly
unexpected types you're going to get."

The unbidden guest at every Palms meal was death.  Sensible residents
did not brood about his presence; they remembered some of the reasons
why they had entered the Palms and accepted their advancing years with
equanimity and a resigned sense of "So be it."  Some, on whom the
burden of age was debilitating and repugnant, would occasionally even
say to themselves: I'll be grateful when he comes knocking, but they
were a minority.

All were aware of death's constant presence; they could not avoid his
shadow if they wished.  A friend would die.  A bridge partner would
suffer a stroke and be moved into Assisted Living, no longer able to
take her meals in the dining room or to linger afterward for the
evening card foursome.  And occasionally one of the older residents, as
he left

the dining room, would bid effusive farewells, much more
protracted than the dictates of friendship would have demanded; he
wanted to say a fond good-bye to his friends because there had been
signals warning him that death was near, and in the morning he would be
found dead.  In such a case most of his acquaintances would tell one
another, as they did when Fred died: He came to the kind of end he
would have wished.  And three days later Reverend Quade, in her
obligatory memorial service, would speak of the tranquillity with which
the deceased had passed away.  In Fred's case the afternoon service
coincided with a rather noisy storm marked by flashes of lightning and
loud claps of thunder, and on the spur of the moment she improvised:
"We seek refuge from the storms of life and if we are fortunate we find
a safe haven.  Our beloved friend has found eternal peace in the bosom
of our Lord."

Death is, of course, universal; man is not the only animal fated to
die-sometimes arbitrarily, without warning, or hideously, or
capriciously in a manner that has no meaning.  When Muley Duggan led
some two dozen of the residents to a nearby racetrack for the races and
for a convivial lunch, neither he nor they could have foreseen they
would encounter death that pleasant afternoon.

"The real reason I've arranged this," Muley explained as his friends
settled down for the ride to the track, 'is so we can see this
spectacular filly, In For A Penny, who is beginning to look as if she
might have a chance to win the Kentucky Derby.  There hasn't been a
filly winning that race in years.  So we can look her over at the
beginning of what could be a gallant career."

At the track, where he was well known because of his affiliation with
racing in New York, he was allowed to take the Palms people into the
paddock, where they could see In For A Penny close up, and they found
her to be a most handsome young lady, with her chestnut coat, fine
head, bright eyes and an auburn mane and bushy tail.  Muley's male
friends praised the horse's conformation, assuring one another:

"She looks as if she could run," while the women were impressed by her
delicacy of manner: "She conducts herself as if she were a great lady,"
and Muley assured them: "That's just what she is."

The group was so taken with the famous filly, already the winner of
several important races in which she had handily beaten the best of
the

young male colts, that most of the people wanted to place bets on
her in the big fifth race of the afternoon, but Muley warned them:
"Don't get carried away by her looks.  Remember, she'll be racing
against young male horses, and sad as it is, the males usually win.
Stronger, better wind, more determination."

"Male chauvinist pig!"  one of the women cried, and she led her friends
to the betting window to place their five- and ten-dollar bets on the
filly, but Muley now contradicted himself by warning them: "You can see
by the board that In For A Penny is going to start as the heavy
favorite, so your odds are not going to be very attractive.  You bet
two dollars and if you win you're paid back only one extra dollar
because everyone else is betting on her, too.  But if you are lucky
enough to bet on some other horse who beats your filly, you might win
ten or twelve dollars."

Despite this warning, which two other practiced bettors confirmed, the
Palms contingent insisted on backing the favorite, especially the
women, who were moved by considerations other than winning a few
dollars: "Wouldn't it be great if she beats all those colts?  Let's
give her our support."

The Palms people did not wager much on the first four races because
they knew nothing about the horses running, but almost everyone placed
at least a two-dollar wager on the charismatic filly, while Muley
Duggan, as the sponsor, bet one hundred dollars on her to win and fifty
on her to place, or finish second.  He instructed the cautious women
bettors how to bet win-place-show, which covered the horse if it won or
placed second or third: "But you understand that since she's the
favorite, she's likely to finish among the top three, so you'd hardly
win anything with such a bet."  However, just to be in the game, some
of the women did make such bets, and before the start of the race they
were just as excited about their prospects as were the daring women who
had bet up to fifty dollars on the filly to win.

It turned out to be a perfect day for racing in Florida: warm with a
cool breeze now and then, sun shining but tempered by casual clouds
drifting by, the grass on the oval a bright green, the red flamingos in
the man-made lake active in beguiling ways, the track raked clean and
without blemish.

"You couldn't ask for much improvement," Muley told his companions.

"And that lunch was pretty acceptable, too."

When the seven competing horses for the fifth race-five colts and
two fillies-were brought out to the area behind the big mechanical
starting gate, they milled about for some minutes, and a few proved
difficult to lure into the gate.  In For A Penny entered her starting
stall like a well-trained lady and waited almost scornfully for the
ones who were causing trouble.

When all seven horses were in position, their noses protruding from the
gate, Penny looked to be the prize of the lot, and the Palms contingent
cheered loudly as she broke handsomely from the gate, rushed to the
lead position and came into the first turn clearly in command.  The
cheering was loud and reassuring.  This filly was more than a match for
the five male horses, and she seemed well on her way to a victory.  One
of the Palms women hammered on Muley's shoulder: "You know how to pick
them!  Look at her gallop," and Muley said: "If she does gallop she'll
lose the race," and the women, not understanding his distinction,
shouted: "Look at her go!"

Two seconds later this same woman uttered the first of the agonized
screams that would fill the stands: "My God!  What's happened?  She
fell!"  Wild cries swept the crowd as they looked in horror at the
fallen horse, her left front leg jutting up into the air at a crazy
angle.

Obviously, it was shattered.

The filly's owner now faced a cruel decision.  The race itself ran to a
finish, with one of the colts winning at 8 to 1. Trained crews rushed
out to tend the stricken filly, and one glance proved that she was so
severely damaged that she would have to be 'put down," the equestrian
euphemism for killing by means of a pistol shot behind the ear.

This was not an automatic decision to make, for it had been amply
proven that a racehorse with a broken leg could be saved, at a
punishing financial cost, if the leg was splinted and the horse treated
like a delicate infant for a protracted spell.  The life could be saved
but the horse would never race again, a perpetual expense to the owner.
The sensible solution, proven time and again, was to shoot the horse
immediately.

"What is that man doing?"  the woman at Muley's elbow screamed.

He said: "Better not look, Mrs.  German," and with his right hand he
turned her face as the track attendant aimed the revolver and shot
three times into the filly's head.

Before the start of the sixth race, clean-up crews had hauled away the
carcass, spread sand over the bloodstains and declared the track fit
for resumption of the afternoon's card of three more races.

The effect of these events on the group was harrowing.  Muley explained
that racehorses are so carefully bred that they become fragile
creatures: "A leg can snap at any time.  Even the slightest twist
outside of normal can do it.  Down he goes."

"But this wasn't a he," Mrs.  German moaned.

"This was a beautiful young female horse.  It's so unfair."  He thought
it best not to explain that the destruction of the filly had been a
commercial decision.

"Do they always shoot them just because they hurt a leg?"  she asked.

"Ma'am, a horse is a big, heavy item.  The leg is fragile, might never
really mend.  It's the humane thing to do."

At these harsh but true words, she burst into tears, and her pain was
so evident that Muley put his arm about her and whispered: "Mrs.

German-Nancy, it was inevitable," but she would not be consoled.

The sudden, arbitrary death of this splendid animal was too much for
her to absorb, and she could not stop weeping.

When they got back to the Palms, Muley Duggan and Nancy German did not,
like the others, go to the comforting cheerfulness of Gateways but to
the second floor of Health, where, in Assisted Living, their spouses
waited: Marjorie Duggan as frail and beautiful as ever, Richard German
almost as tall and energetic as he had been forty years ago.  Neither
Muley nor Nancy could explain to their mates what had happened that
day, for even the simplest communication was impossible, but
nevertheless they spoke.

Muley said: "You'd have loved the filly, Marjorie.  She was one of the
finest horses I've seen in years.  And she was winning all the way
until it happened."  He paused as if to allow her time to ask: "What
happened, Muley?"  but the question never came.

Nancy German told her husband: "Richard, the racetrack was so neat and
well cared for you'd have approved.  And the races were interesting,
but there was this awful tragedy."  He, too, did not ask for details,
so she did not tell him about the shooting.

Andy had been in residence almost four full months before he was
again forced to witness death, but this time it entailed the complete
cycle of residence at the Palms.  The happily married Clements lived on
the fourth floor, as typical a pair as the halls contained.  He was in
his early eighties, she in her late seventies, and they had obviously
been of ample means, for they occupied one of the larger suites,
frequently took their lunch at some restaurant in Tampa, and
contributed generously to the collections made at Christmas for the
staff.  They were an amiable pair whom everyone liked; he was a good
bridge player and she a volunteer helper on the floors of the nursing
building.

Their lives were progressing in the orderly way they had planned, for
when they were in their forties they had started to invest their income
so that they could one day find refuge in some place like the Palms.
Their two children, safely married and with good jobs, and four
grandchildren came to visit them periodically.  One would have
predicted that it would be some years before they would be interested
in Assisted Living, for Mrs.  Clement still drove their Cadillac and he
took a walk almost every day when it was not raining.

And then their placid routine was shattered when Mr.  Clement, while
climbing out of the bathtub, fell and broke his left hip.  Since he
would require nursing care after the operation, he was immediately
moved to a comfortable room on the Assisted Living floor.  Normally he
would have remained there for five or six weeks receiving the best
medical attention but, as in so many similar cases, his weakened
condition produced severe pneumonia, known in previous centuries as
'the old man's friend' because it was often the agency for a quick,
peaceful death.  It served that function with Mr.

Clement, whose condition declined so rapidly that it was clear to all
that he was dying.  He was therefore moved to a sunlit room on the top
floor, Extended Care, where he would be expected to live for the brief
remainder of his life.  He realized what the move upward meant but was
not distressed by it.  He told his wife: "We've had a decent life, fine
children, wonderful grandchildren, everything in good

order to protect you for as long as you live-the end of the
trail, and I have few regrets."

His stay in Extended Care was short, for the genetic inheritance with
which he had started life eighty-two years earlier dictated that he had
run his course.  Everything was happening according to schedule, the
only remarkable aspect to his dying being the ease with which he
accepted it.  The end came one Thursday night at about eleven
o'clock.

His wife, who had been sharing his room with him, was at his side when
he died, holding his hand until it began to grow cold, then folding it
gently over his heart.  His death could be seen as almost a beautiful
rite of passage.  A responsible life had been lived and had ended with
as much dignity as death ever allowed.  If no angels sang at his
passing, neither did friends and neighbors wail in unseemly grief.

Andy monitored with care the established routine for handling the
event.  At midnight Dr.  Farquhar appeared to certify that Clement had
died of natural causes.  This done, an hour was spent dressing the body
in street clothes and lifting it from the bed onto a rubber-tired
stretcher, which was wheeled into the elevator before it could be seen
by anyone except the nurses who had helped in the arrangements.

With Mrs.  Clement remaining beside her husband's body, the elevator
went to the ground floor and the stretcher was whisked out an
unobtrusive door that some sardonic wit had labeled Avernus, regarded
by ancients as the gateway to hell.  Once outside, the body was placed
in an ambulance, which sped down a rarely used unnamed path.  This soon
connected with the lane leading into the mall, from which the ambulance
would go across town to the Tampa morgue.  By three in the morning,
with none but the medical staff aware that a death had occurred, the
corpse was safe in its temporary resting place, from which morticians
would retrieve it before nine the next morning.

At breakfast in the Palms a notice edged in black appeared on the
bulletin board stating that at midnight Charles Clement had died
peacefully and that memorial services would be held two afternoons
hence.  At these services, attended by more than half the residents,
Reverend Quade conducted a shortened version of the noble Episcopal
service for the dead, after which fruit punch and gingersnap cookies

were served, with one person after another telling his or her
neighbor that it was the kind of death Charley would have wanted.

Death was not yet finished.  When Mrs.  Clement returned to her
fourth-floor suite and realized she must now live alone in those
spacious rooms, she suffered what could only be termed 'a collapse of
the spirit," with the result that, for no medical reason that Dr.

Farquhar could detect, she too died.

"She died," the women in the Palms averred, 'because of a broken
heart," and they noted with unvoiced approval that she, like her
husband, had died peacefully in bed.

"It's the way God intended them to go," several of the women said, and
they watched, again with approval, the orderly manner in which the
Clement children and grandchildren appeared at the Palms with their own
movers to clear the apartment of their parents' belongings.

By the end of the next week Mr.  Krenek had sold the empty Clement
apartment to a couple from Skokie, Illinois.  Andy, reviewing the
transition, concluded that it had been handled with admirable
efficiency, and he praised his staff for their un stinting help.

Very shortly after the calm departure of Mrs.  Clement, Gus Ranger, an
overweight florid man in his early seventies, dropped dead of a massive
myocardial infarction.  Quite a few men at the Palms said they were not
surprised that a man like Gus, who took little care of himself, should
have died in that dramatic fashion.

"He asked for it' was their opinion, but they were appalled by where
his death occurred.

Word sped rapidly throughout the Palms: "Have you heard where Gus died?
In the bedroom of one of Tampa's prostitutes!"

Yes, a friend of the woman in question had called 911 rather
frantically from a Tampa rooming house with the news that 'a gentlemen
has dropped dead in the living room of the apartment house," and when
the rescue squad arrived, the attending medic jotted in his notebook:
"Corpse showed every indication of having been hastily dressed by
someone not himself and dragged down to the reception area."  Tampa
newsmen who saw the official report had to explain in their stories how
Gus Ranger happened to be in that unusual location and whom he was

visiting.  They used the convenient phrase 'a longtime friend,"
and left it to the reader to deduce who that friend might have been and
the circumstances of Ranger's sudden demise.  But only a retarded
reader would have failed to understand that Gus Ranger, aged
seventy-two and a respected resident of the Palms, one of Tampa's
finest retirement complexes, had dropped dead in the apartment of a
well-known local prostitute.

Managing editors could see no reason for exploring self-evident truths
or developing the fact that Mr.  Ranger had been in the habit, for some
time, of visiting this young lady and showering rather generous gifts
upon her.  Of course, the rumor mill at the Palms quickly developed the
parts of the story the news media had censored, and various witnesses
testified in private to the fact that Gus Ranger had developed a habit
of absenting himself from his quarters in the morning for what he had
described as 'business affairs in town."

Privately some raffish men whispered to one another: "What a glorious
way to go!"  but most of them thought to themselves: Jesus!  I'd hate
to be caught in a mess like that.  My farewell performance.  No thanks.
And many thought: I couldn't do that to my wife.  And the kids.

This feeling was strengthened by reports of how traumatic Gus Ranger's
ugly death had been for his wife.  Reverend Quade was not invited to
deliver a eulogy at the memorial services at the Palms, and for the
good reason that no such services were offered.  Dr.  Zorn had given
orders: "If Mrs.  Ranger insists, of course we'll go ahead, but she
hasn't left her rooms, so let's not suggest it."  Muley Duggan
persuaded a few men to attend a service he organized at a downtown
Tampa mortuary but no wives participated.

Andy did not wait long before visiting with Mrs.  Ranger in her lonely
apartment.  When he sat with her he gave her the warmest assurance that
he personally would see to it that she was offered a smaller apartment
if she decided to remain at the Palms, which he advised her to do.

"You have your friends here.  You already know everyone, and there's no
need whatever to try to find a new life."  When she said she'd have to
think about costs now that Gustavus was no longer there to manage their
investments, he reminded her: "You know that your monthly costs drop
with only one of you occupying these quarters, and they'll drop even
more if you accept my invitation to take smaller rooms."

But since this was his first experience with a widow who might be
staying on, Mrs.  Clement having died almost simultaneously with her
husband, he wanted to make sure that the women in the center knew that
he and his staff would do everything in their power to make adjustment
to a single life easy, friendly and inexpensive.  He stayed with Mrs.
Ranger more than two hours, reviewing all aspects of her financial
situation and especially the alternatives she might consider: "I want
you to share with us your plans and your hopes, and if you'd do better
shifting to some other retirement area, we'll give you the warmest
possible cooperation.  Mrs.  Ranger, we were established to provide
comfort and safety to people like you.  You've made yourself a member
of our family, and as family members we'll give you sound advice.  I
hope you'll stay with us."

He asked also about her family members and what she might expect of
them.  He wanted to know what relations she had with any Tampa church,
who her doctor was, what condition her will would be in with Gus gone,
and whether she would feel more at ease if she had a room on the lower
floor, or even one on the top floor with a broad view of the colorful
swampland to the north.  Everything he did in those mournful days
proved that he was personally interested in her welfare and was
prepared to serve as a business counselor to succeed her husband.  He
did not have to pose as a Good Samaritan, he was one.

But in the days that followed, when Mrs.  Ranger was weighing carefully
her choices, Andy became aware that one staff member was treating this
widow less as a distraught elderly client than as an elderly beloved
sister who faced great emotional problems.  He heard Nurse Varney say
one day when she was counseling Mrs.  Ranger about some minor medical
matter: "You don't gots to bother with expensive tests for a thing like
that.  Go to the Eckerds down the way and ask the pharmacist what's
best for a sinus attack.  He'll tell you, total cost maybe four-fifty
for one of the new medicines."  He had noticed before that when Nora
spoke to residents about the serious problems of life, she reverted to
the Negro dialect of her youth, the one her mother had used when
sharing her folk wisdom.  Now he heard her say: "What you really gots
to do, Mrs.  Ranger, is start right now to get out into the community.
Go to a restaurant now and them.  Help out in some church.  See if the
school down the way needs a morning helper to read to the children."

When Mrs.  Ranger said: "I'm ashamed to show my face.  I'm here
in your office only because I have this sinus pain," Nora led her to a
corner chair, pulled one up for herself and lectured the bereft
widow:

"Mrs.  Ranger, we don't want no more such talk in this place.  Listen,
my dear friend," and Andy saw his nurse take Mrs.  Ranger's hands in
hers, 'every peoples gots trouble, lots worse than yours sometimes, but
they live on, find trusted friends, dress up each Saturday night as if
it was a party, and get on with their lives."  When Mrs.  Ranger held
fast to the nurse's hands and began to cry, Varney snapped: "None of
that!  Did you know that Mrs.  Rexford has a daughter, bad brain
damage, her mind stopped growing about age five.  Girl's in a home for
the past forty years.  And poor Mr.  Duggan, his wife doesn't even
remember who he is, that's trouble too, Mrs.  Ranger.  And the
ambassador, his wife died young, I cared for her, a lovely woman, he
like to died, but you see him now, active in his corner with his
talky-talky men.  He keeps living."  For some minutes she continued
sharing with Mrs.  Ranger the secrets of the Palms until it sounded as
if half the residents lived with some dark misery in their closets:
"But they keep on living.  Peoples gots to stay in the fight.  You know
what they say in the football television?

"No pain, no gain."  You got pain, yes, but so do all peoples."

"Yes, but mine is so public."  She burst into tears and covered her
face with her hands, as if trying to hide from cruel strangers.

"I'm so ashamed."

For some moments the nurse allowed her to cry, then said softly:

"Mrs.  Ranger, they'll whisper about it for maybe a week, then it'll
die down.  What you do is learn to hold your head high.  You're a proud
woman.  You're a good woman, as good as any of them, and if they stare
at you, stare right back, head high as if you were saying: Go to hell!
and in one week it will pass."

When the widow continued to weep, Varney grabbed her by the shoulders
and shook her, saying in a harsh voice: "Snap out of it, sister.

How do you think I felt when my man left me with no money, no job, and
two small daughters?  How much shame did I have to swallow?

Mrs.  Ranger, all peoples gots misery.  We all gots shame.  And yours
is standard issue.  Come on!  Smile!"

When Mrs.  Ranger composed herself she said: "I'll see what the man

at Eckerds has to say about my sinuses."  There was a pause,
then:

"Nurse, may I kiss you good-bye?"

"I ain't leaving," Varney said, 'and neither are you," and she embraced
the widow.

On the last day of April, marking the completion of Andy's first four
months at the Palms, he conducted a tour of inspection to check on the
buildings and grounds.  He started by having Ken Krenek drive him out
to the first of the great palm trees reaching toward the clouds, and he
inspected each one as he walked westward toward the massive gateway to
the buildings.  He understood that in due course one or another of
those majestic trees would die and have to be replaced, but he could
detect none that seemed threatened: "Anyway, those out in the savanna
grow so fast that replacements would be possible."  Then he had a
better thought: If they can do with dead palms what they did to replace
those Brazilian pepper trees that were so splendid, we could move in
nearly mature palms and no one would be able to spot the difference.

With mixed feelings he turned his attention to the left-hand side of
the entrance row, for although the Brazilian pests had been sawed off
and rooted out, they had been replaced, through the generosity of Mr.

Taggart, by a gorgeous line of nearly full-grown oleander shrubs that
formed a sturdy hedge of dull-red flowers set among bright green
leaves.

"They're curious," Andy said as he checked their growth, finding each
of them firmly rooted in the short time since the cutting of the
Brazilians, 'because they carry a deadly poison.  There are stories
galore of lost wanderers who slept under a growth of oleanders and died
because the poison from their leaves dripped down on them.  Probably an
old wives' tale, but we do know their leaves are poisonous to eat.  Yet
how beautiful!"

He also walked south of the buildings and saw with a pang of regret
where the ruins of Judge Noble's chair rusted at the edge of the
channel.  The big pool was in good condition and the walking path

south had good footing.  The Palms is a sanctuary tucked within
its own little paradise.  I hope we can protect it."

Indoors, he inspected first the health center and was pleased to
observe the bright colors of the new paint in the hallways of Assisted
Living and Extended Care.  He shuddered when he passed Room 312, where
Mrs.  Carlson still survived amid her wonderland of tubes, insertions
and electrical connections, but he had learned to keep his mouth shut
about that medical aberration.  He had been indoctrinated in the fact
that neither he nor any other Palms employee had anything to do with
that room.  What happened there was determined by the courts of
Florida.

When he reached Gateways he was gratified to see it was such a treasure
in the retirement system, clean, cheerful, well ordered and brightened
with vases of flowers.  But he was less happy when he reached the
ground floor and telephoned the main desk to send him a key so that he
could inspect the new hobby room.  When Delia, the efficient
receptionist, said: "I have strict orders.  No one can go to that room
without being escorted by one of the five men building the plane," he
asked: "Not even me?  This is Dr.  Zorn."

"I recognized your voice, sir.  No, not even you."  He asked Delia to
roust out one of the team, and in time Maxim Lewandowski, the aged
scientist, appeared.  The accident that it was he who came to represent
the tertulia of dreamers was unfortunate in that he seemed so terribly
old and frail that to think of him building an airplane was, frankly,
ridiculous.  But once inside the crowded room he became a different
person.  Moving to his lathe, he pointed to a blueprint diagram that
gave the specifications for the propeller; he was obligated to follow
the specifications to the smallest fraction of an inch.  The old fellow
had mathematical measuring devices that enabled him to do this, and a
handsome twist of laminated wood sanded to a micrometer smoothness and
covered with a hard, luminous varnish glistened in the morning
sunlight.

"How about that motor you men ordered?"  Andy asked, and Lewandowski
became once more the professor: "Dr.  Zorn, the terms "motor" and
"engine" are not synonymous.  A motor is a device that runs on
electricity provided by some outside force.  Like the motor that
operates the windshield wiper.  An engine is a device that runs on the
power

it generates itself."  He paused, then used an illustration he
had often used in his seminars: "Can you imagine how long the wires
would have to be if you tried to power an airplane on a flight from New
York to Tokyo using a motor?  Or just as bad, how big the batteries
would have to be to store that amount of electricity?"  Patting the
front end of the fuselage, he said: "To fly a plane, you need an
engine.  To operate this wiper, a little motor."  When Andy said he had
it clear, Lewandowski said: "And where do we get the electricity to run
this little motor?  From a generator attached to the gasoline engine.
On a big passenger plane it automatically generates enough electricity
to light the cabin, air condition it and operate all the instruments in
the cockpit."

When Andy left the old man and his shimmering propeller, he had a
better understanding of what the tertulia was attempting, but when he
returned to his desk he was overcome with apprehension: "Good God!

What if those old-timers do finish their plane, and take it out there
and it gets into the air for eight or ten minutes and then crashes-
with everyone watching-and maybe even television cameras?  What a
horrible mess.  The story would make news across the nation.  I wonder
if I could persuade them to call this off.  They'd object, of course-
they've invested so much time-but I'd better try."

He did, that evening, when he dropped by table four and asked if he
might join them for dessert.

"You can join us," Senator Raborn grumbled, 'but you can't have
dessert.  The yogurt machine is on the blink."

"We'll get it fixed," Andy said for the twentieth time.  When he had
the attention of the four men he asked, tentatively: "Have you ever
thought of just building the plane, leaving out the engine and giving
it maybe to some industrial arts school in Tampa?"

Ambassador St.  Pres stiffened as he had in central Africa when his
second in command at the embassy had asked: "Mr.  Ambassador, do you
think it prudent to take up flying ... at your age, I mean?  Why
couldn't you rely-' He had stared at the young man and growled: "That's
an asinine question.  Schedule me for lessons on Wednesdays and
Fridays."

Now, with equal stiffness but softer language, he said: "Dr.  Zorn, I
appreciate why you might be apprehensive about us old men taking our
plane into the air over your establishment, but I assure you that was
fully our intention from the moment we started building The Palms One,
which is what we shall christen her.  And our determination

has never wavered.  I have renewed my license every year as an act of
faith.  And I believe the senator does, too."

"Mine lapsed, but I can get it renewed," Raborn said.

"So the plane will fly, Doctor, in capable hands."

"I wish you well.  I'll be there to cheer you on."  But as he left the
table he paused, looked back at the four elderly dreamers and made the
wish:

I pray that you clowns can keep it in the air, just this once.

Back in his office, he leaned back in his chair and juggled John
Taggart's imaginary blocks: This place is in great shape, Gateway is
filled to capacity barring those two small rooms that Miss Foxworth
likes to hold in reserve for unexpected visitors.  Extended Care also
filled to capacity.  Then he smiled self-indulgently: But my best move
was to bring good old boy Bedford Yancey and that wife of his,
energetic Ella, down here.  With their help we have Assisted Living
under control and almost flourishing.

He considered for a brief moment whether he should write a report on
his successes to Mr.  Taggart, but his cautious nature warned him
against premature boasting: "Play it cool, Andy my son," he could hear
his father saying.

"Save the letters to Chicago until you have this place locked into the
profit column."

As he sat at his desk, a strange lethargy began to creep over him.  For
a long time he did nothing, just letting his thoughts drift aimlessly,
but he slowly realized that although he was pleased by the apparent
success of the initial period of his custodianship, there was a deep
unhappiness within himself-a gnawing dissatisfaction with the state of
his personal life.  He disliked being introspective-he feared the
danger of plumbing the depths-but now he was forced to ask himself: Why
am I so restless?  Why, at the very moment of having turned this place
around, am I so damned .. . unhappy?  The instant he
acknowledged-almost involuntarily-that he was profoundly unhappy his
defenses crumbled: I've lost everything that matters to me-my wife, my
work in the clinic.  I was meant to be a doctor... and I threw it all
away... through cowardice.  I allowed that damned lawyer to destroy my
life.

At this moment his protracted soliloquy was interrupted by a committee
of three women who were part of a group rehearsing for an amateur gala
to be performed on Memorial Day.  They were dressed in the costumes
worn by little girls around 1910: short, frilly dresses, lace collars
high at the neck and saucy little blue-and-white hats.  Their

spokesman explained: "Dr.  Andy, we've added a new song to our
number and we want you to be the first to hear it.  Come along,
business matters can wait till tomorrow," and they dragged him off to
the rehearsal room.

They were three from a group of seven, who, after apologizing for the
fact that not all had memorized the new words, gathered about Andy and
sang:

"Dr.  Zorn, he's a dandy Hair not red but kinda sandy.  He gives kids
an extra candy We feel safe to have him handy Give the guy a shot of
brandy."

Muley Duggan, passing by on his way to his apartment after visiting
with his afflicted wife in Assisted Living, heard the last line and
scurried about to get a bottle of brandy and returned to pour Andy a
hefty portion.  Normally, Andy was abstemious, having watched several
doctor acquaintances of his washed down the tubes in a flood of
alcohol-"I like a cold beer now and then, but that's about it'-but this
day had been so painful and the song such a vote of confidence that he
guzzled the brandy with alacrity, grateful for its comforting heat
passing through his veins.

Leaving the chorus and Muley, he returned to his office, where he began
brooding again.  Bitterly he asked himself: Is this to be the balance
of my life?  The respected director of a refuge where delightful
elderly women idolize you and the long years drift by?  ... At this
moment, unaccountably, an inner voice he did not recognize as his own
spoke decisively: Get yourself back on the main track.  Find someone to
share a life with.  And don't postpone it till you're fifty.

Suddenly lighthearted, he went to his apartment and, thanks to the
brandy, was asleep in less than ten minutes.

Shortly after that emotionally wrenching night when he had had to
sort out his personal long-range goals, he received a letter whose
potential for ugliness made perspiration spring to his forehead.  It
came from Chattanooga and carried in the upper left-hand corner of the
envelope the ominous name of Dr.  Otto Zembright, M.D. Before daring to
open it, Andy leaned back, visualizing the Tennessee doctor who had
been so proficient and helpful that snowy New Year's morning when the
girl lost both her legs in the car crash.

He remembered Zembright's cautionary counsel never to play the Good
Samaritan: "I'd have got the hell out of there as soon as I could," he
had said.  So it was unlikely that Zembright himself was about to bring
any kind of action against him, but he might be warning him about
someone who was.  Memories of his days on the witness stand flooded
back to him and he shuddered.

Unable to postpone opening the letter indefinitely, he gingerly slipped
a desk knife into the fold at the top and took out the single sheet of
paper.  It contained only three sentences; "Father of girl is grateful.
Nothing to fear.  Please call me."

Andy should have been relieved by the letter, but he was so afraid of
yet another lawsuit of some kind that he sat numbly for several
minutes.  Finally he grabbed the phone nervously, found Zembright's
number by calling information, and said, his voice trembling: "It's
Dr.

Zorn.  I received your letter.  What does it mean?"

"What it says.  Nothing to fear from this end."

When Zorn sighed in relief, Zembright explained: "Oliver Cawthorn,
Betsy's father, is a first-class human being.  One of God's finest.  He
knows you saved his daughter's life and wants to see you on a most
important mission."

"Like what?"

"Not over the phone."

"Should I let him come?"

"Yes.  I think highly of him, the way he's behaved the past several
months, and I want to come down with him."

"Is it that important?"

"Yes."

"In spite of the advice you gave me?  To get the hell out if you
interfere in a car wreck?"

"Conditions vary."

Reluctantly Andy agreed that Zembright should fly down to Tampa right
away and bring Oliver Cawthorn with him.

Still apprehensive about the purpose of the visit, Andy drove north to
Tampa International and waited nervously for his guests to deplane, but
as soon as he saw big, gruff Otto Zembright and his smiling face he
began to relax, thinking: If he's engaged in some conspiracy to do me
in, then the whole world is rotten.  And when Oliver Cawthorn stepped
forward to be introduced, his anxiety vanished, for the man, who was
lean, with sandy hair and sparkling eyes, had an obvious desire to be
his friend: "Dr.  Zorn!  Our family owes you a tremendous debt, me more
than the others.  You gave me back my daughter."  He did not try to
embrace Andy or shake his hand excessively, but his fervent tone
conveyed his deep gratitude.

As Zorn sped them south along Route 78 and turned right on the cutoff
to the Palms, the visitors saw the stately march of Washingtonias
facing the brilliant oleanders and were impressed by the aesthetics of
the place.  When Andy took them briefly through Gateways and Health,
they found much to admire there also.

"You seem to know what you're doing," Zembright said, and Cawthorn
agreed: "A person in this place wouldn't feel she was in prison- or the
morgue."

"But could we see the rehab center?"  Zembright asked.  That's why
we're here," and when Andy showed them the spacious quarters with the
most modern machines, the older doctor said to the other visitor:

"Oliver, they definitely have the wherewithal.  But do they have the
experts?"

"We'll see the man in charge later," Andy said.

Discussion of their trip started immediately upon their return to
Andy's office: "Dr.  Zorn, my daughter Betsy believes, and with good
reason, that you saved her life.  Dr.  Zembright agrees.  And we're all
most deeply grateful to you for your timely help.  You didn't have to
do what you did, or stay with her at the hospital."  Cawthorn
continued;

"But her health .. . her recovery, it's not going well.  Primarily
because she's given up hope."  With tears starting to fill his eyes, he
reached in

his pocket for a series of photographs showing his legless
daughter reclining languidly among pillows, her face ashen, her eyes
listless.

Andy was interested to see that the girl in whose life he had played an
important role was even more attractive than he remembered, but was
saddened by her obvious loss of interest in life: "She was a more
determined fighter that morning when I lifted her into the
helicopter.

Haven't you started therapy?"

"Yes," her father said.

"Dr.  Zembright's been insistent.  But she refuses to cooperate.  Has
even suggested, once or twice, that her life is over."

"Oh, no!"  Andy cried.

"You must force her to get out of bed-to try to walk, as soon as she's
fitted with artificial legs."  Turning to Zembright he asked: "Have the
stumps healed properly?"

"Better than could have been expected, considering the crushing and
splintering.  They're solid, like rocks."

"And her knees?"

"We saved them."

"Then you must get on with the job.  Around here we perform miracles
with people who've run into bad luck."

Cawthorn interrupted: "Losing both legs isn't bad luck.  It's a
horrendous experience, and Betsy is terrified."

"I apologize," Andy said.

"It must have sounded like a doctor's mechanical response to a personal
tragedy."

Cawthorn thrust out a big, competent hand and gripped the younger man:
"You must help.  She's given up hope," and Andy could see that the big
man was again close to tears.

"It's simple," Andy said with great force: "You've got to jolt her out
of such defeatism.  It can be done, you know.  We do it here all the
time, and a good therapist in Chattanooga could do the same."

"I know that," Cawthorn said.

"But Betsy's hooked into a kind of monomania, they call it.  She's
convinced that since you were the one who saved her life, only you can
save her now."

Andy stared at the floor.  Very softly he said: "All doctors encounter
monomanias that cannot be explained.  They make no sense, but if they
persist they can destroy a life."  Lifting his head, he stared at
Cawthorn and asked: "But if she's stuck on this idea, what might I do
to help?  Fly back to Chattanooga with you and talk to her?"

"No," Zembright interrupted.

"We discussed that and concluded that a brief visit from you might do
more harm than good."

Now Cawthorn took over: "We want to find her a place in your
institution-away from Chattanooga and its negative memories-a new life,
new hope."

Andy considered this radical suggestion, then said carefully: "Are you
men aware that I'm not certified to practice medicine here in Florida?
I'm just the director of the Palms."

Cawthorn turned to Zembright: "Does that change anything?"  and the
Tennessee doctor said: "Not at all.  I know that Florida makes it
extremely difficult for an outsider to come in here and take business
away from the locals.  Zorn wouldn't have to be her doctor.

Administrative overseer would be enough.  Surely he has a licensed
therapist on board."

"One of the best," Zorn said and phoned to have Bedford Yancey, the
demon practitioner from Georgia, come in, but before he arrived Nurse
Varney entered with a routine message from the dining room.

Zorn said: "If your daughter were to come here, it wouldn't be me or
the therapist who saves her.  It would be this therapeutic genius. Nora
is a healing angel."

That's a wonderful skill to have," Zembright said.

"We could use you in our shop."

"I try," Nora said as she smiled at the visitors, and when she was
gone, Zorn said: That wasn't flattery.  Nora has healing in her hands,
her smile, and her laugh.  I couldn't run the place without her."

Now Bedford Yancey entered, all enthusiasm and cracker charm, but
before he could speak Dr.  Zembright sprang to his side and cried
"Yancey?"  as he extended his hand.

The same."

The wizard from Vidalia?  We heard about you in Chattanooga."

Turning to Cawthorn, he explained: This man performs wonders with
professional athletes.  Saves careers."

"But can he do the same for a young woman who lost her legs?"

Andy broke in: "He's wonderful with young people, I saw him treating
them in Georgia."

"So you're working down here now?"  Zembright asked, and when Yancey
nodded, Zembright assured Cawthorn: "Your daughter would be in good
safe hands with this one."

Now Zorn interrupted to explain: "Mr.  Cawthorn's daughter lost
both legs in a car crash, and these men are thinking about bringing her
down here for us to rehabilitate her-get her to walk again."

Yancey impressed the others by his barrage of sharp questions:

"How old is she?"  Twenty-three.

"Were her knees saved?"  They were.

"Are the stumps solidly healed?"  Surprisingly so.

"With a strong skin flap covering them?"  Yes.

"Before her accident, was she ever in any way athletic?  I mean, could
she move about freely?"  Very strong in tennis.

Club champion in mixed doubles.

"And how has she reacted to therapy?"  She refused to try any
further.

"Deep depression?"  Yes.

"But her health otherwise was always strong?  And maybe could be
again?"

Yes, if she allowed it.  At the conclusion of his questioning Yancey
looked at the three men and said quietly: "Can do.  Have done.  Will do
again."

Cawthorn, afraid that Yancey was throwing words around loosely,
interrupted: "Could you give me an idea of how long it would take to
get her walking?"

Yancey turned immediately to Dr.  Zembright: "Stumps tough to the
touch?"

"Very clean.  Sutures out.  The very best, I assure you."

"Good!  I accept your diagnosis, so now I'll give mine.  Pencil ready,
Mr.  Cawthorn?"  and with the ebullience of a confident young man who
knew his business he rattled off the astonishing figures: Today's the
first of May.  Let's say you get her down here by May fifth."

"We'll have her here tomorrow."

"May second I see her for the first time.  She gets her temporary legs
the next day.  She starts with her walker on May third."

"Do you mean that, seriously?"  Dr.  Zembright asked, for Yancey's
program was far faster and more optimistic than any with which he was
familiar.

Yancey turned to address him: "Dr.  Zembright, you appear to have done
a great job with your surgery.  With the toughened stumps you're
sending me I can do miracles.  But your therapist is generations behind
the times.  He's wasted four months.  But we can catch up, and maybe
the rest period will have done her good."

Solemnly Zembright said: "Don't blame the therapist only.  Betsy has
given up.  She's convinced her life is over and wouldn't have accepted
therapy, not even from you.  She's been wasting her time convinced that
she was dying."

"He's right," Cawthorn broke in.

"She's in dreadful shape, really, much worse than he says."  He broke
into tears.

"And we've been powerless to help her feel hopeful.  That's why we need
you, Dr.  Zorn."

"No," Andy said.

"What she needs is Bedford Yancey.  If I didn't believe she'd get the
best possible physical therapy here I wouldn't let her come.  Yancey
will not let her feel sorry for herself.  He's quite remarkable, Mr.
Cawthorn."

Brushing aside the compliment, Yancey resumed his timetable: "On May
fourth she will walk, with her walker and me behind to protect her,
from where we stand to twenty yards in that direction.  I guarantee
it... unless'-he paused ominously-'unless her spirit has been
completely broken and she refuses to respond.  You say she was a tennis
player."

"Amateur category," Cawthorn said.

"But she and I won father daughter doubles at the club."

Yancey smiled at Cawthorn: "Your daughter will be walking without a
crutch or walker by the first of July, and she will be able to dance on
Thanksgiving Day.  I guarantee it."  He looked triumphantly at Dr.

Zembright and said: "Bring her down immediately.  I'm ready!"

The visitors needed to hear no more, and they all agreed that Betsy
Cawthorn, profoundly depressed but in remarkably good physical
condition, would be transferred immediately to the Palms.  That
decided, the men toured Gateways to inspect various rooms suitable for
a young woman in a wheelchair, but Yancey protested: "Don't get hung up
on that wheelchair bit.  And don't buy her one.  Rent it so she knows
from the start it's temporary.  And when she does get it, I'll hide it,
'cause she'll be walkin' shortly, and dancin', too."

Choosing a room in the Peninsula projection that looked out on the
river, Cawthorn said: "I find that one of the comforting things about
this place, Doctor, is that it's solidly built," and Zembright
explained:

"He ought to know.  He's one of Chattanooga's biggest builders."

Cawthorn laughed: "I get by.  Why do you call this place Gateways?"

and Andy repeated the explanation he had once heard Nurse Varney give:
"Because it's the gateway to a better life."

As the visitors drove away from the Palms, Oliver Cawthorn, an
experienced judge of men, said: "Otto, I'm so happy with our
decision.

Betsy has used up what we have to offer in Chattanooga-she deserves new
blood, younger men.  I liked Zorn and he'll start with a great

advantage.  She's convinced herself that he can help her.  Is
that fellow Yancey as good as you said?"

"Excellent reputation for baseball players and quarterbacks.  He must
be equally good with ordinary people, or a place like the Palms
wouldn't have hired him."

As they flew home to complete arrangements for their patient to
transfer to the Palms each devoutly hoped that her life would again be
one that was worth living.

EXPLORATIONS

BETSY CAW THORN REHABILITATION started three minutes after her father
wheeled her into the entrance to the Palms.  It began not with
instructions from Bedford Yancey, the therapist, but with Dr.  Zorn. As
he stepped forward to greet her, he really saw her for the first time;
in January at the bloody scene of the accident he had been aware only
of a woman in terrible pain.

Now he saw a person with a lovely face, though drawn and pale.  A wan
smile of great beauty suffused her face as she grasped his hand and
whispered: "Thank God they found you.  If anybody can help me it would
be you..  .."  and her voice trailed off.

Her introduction to Yancey was decidedly dramatic.  He rushed up to her
and, grasping her hands, pulled her toward him, saying: "A big hello
from the Palms, where your new life begins.  Here you are not going to
be coddled like a fragile Southern belle'-he slapped the metal arm of
the wheelchair-'and we'll get rid of this contraption as soon as
possible, surely by next month, because I refuse to say you are
bedridden or chair-ridden.  What you are, Miss Betsy, is a tough,
feisty tennis player who has run into temporary misfortune.  Your cure
here will be spectacular.  You'll be movin' about, you'll be crawling',
you'll be standin', and so help me God, you'll be walkin' and you will
not be relyin' on this damned chair."

"How soon can she be on crutches?"  her father asked.

Yancey looked at him in amazement: "Mr.  Cawthorn!  We haven't used
crutches in donkey's years.  Too cruel, and they delay muscular
regeneration.  What do we use?"  Yancey almost shouted.

"We use the four-footed walker, one of the great inventions of the
twentieth century, the man who thought it up should win the Nobel
Prize."  And he called for an assistant to bring out that marvel of
modern rehabilitation, a rather large device made of lightweight
burnished hollow steel with four widely spaced legs, each ending in a
heavy rubber tip.  This

ensures solid footing," he said, kicking one of the legs
roughly.

"And since the height of the leg is adjustable, a perfect fit is
guaranteed."

Yancey now called for Nurse Varney to assist him, and when the big
black woman came forward, she gave the younger woman a look of motherly
reassurance and affection.

"Let's lift her up, Mrs.  Varney, and fit her for size in her walker,"
Yancey said and skillfully he and Nora pulled Betsy out of her chair
and moved her into the position she would soon be able to take without
help.  For the present she was held in an upright position within the
protection of the walker the way she would stand as she learned to use
her new legs.  In this unorthodox way she began to feel comfortable
with the two officials at the Palms who would guide her life for the
next months, a redheaded cracker from Georgia and a black nurse from
Alabama.

When Yancey lifted her back to her chair he did something that only a
supremely confident young therapist would have dared.  Without
explanation or apologies he lifted the heavy denim skirt that she was
using to cover what was left of her legs, pushed it aside, and knelt to
examine the two stumps, which everyone else in the reception area now
could also see.  After assuring himself that they had healed nicely he
astonished everyone by actually thumping on them so hard that they made
a sound.  Then, from his kneeling position he looked up at the
astonished Mr.  Cawthorn and said: "Whatever you paid the doctor who
cared for these stumps, send him a check tonight for double.  This is
not good work, Miss Betsy, this is perfection," and with a forefinger
he indicated precisely what it was that gave him hope: "Look at these
muscles coming down from the knee, look at the fact that we have enough
bone in each leg to fit one of the great new mechanical legs.

Look at the strong thighs to which we can attach the supporting gear.

Most of all, look at the flaps of tough skin holding everything in
place, everything toughening up!"  He gave the stumps another bang.

"My God, he's treating her rough," Andy whispered, but Nora had watched
Yancey at work before, and defended him: "He's knocking her down to
ground zero, so she can rebuild."

"On Thanksgiving Day, lass," Yancey continued, 'we'll be waltzin'."

Then he quietly told the Cawthorns: "In this place we perform miracles,
but only with the help of our collaborators-we never use the word
patient around here because no one is sick.  Just discommoded for the

moment.  And in Miss Betsy we have a young woman who's already
made half the recovery.  She has her knees; her stumps-we never use
nice-nelly evasions for that word-have healed magnificently and are
clean and powerful guarantees of her recovery.  Nora and I will do our
best."  Then he became a stern taskmaster: "Miss Betsy, you've been
allowed to waste four months of your life.  If you'd flown down here
the day after your accident, you'd be walkin' now.  You've been a bad
girl and I ought to give you a good, old-fashioned spankin' on your
bottom."

"Good God!"  Andy cried as he saw the familiarity with which Yancey
treated Betsy.

"She could sue us all for sexual harassment," but again Nora defended
him: "Look at how she's reacting," Andy studied his newest resident,
and saw to his surprise that she was gravely shaking hands with the
Georgian: "Up there I wasn't ready for treatment, but now I am, Mr.
Yancey.  I want to walk.  Teach me how."  He squeezed her hand, but her
gaze was fixed on Andy.

That evening, as if nothing unusual had occurred at the Palms during
the day, one of the young waiters was sent to Betsy's room to help her
into her wheelchair and bring her down to the dining room.

Dr.  Zorn had arranged for her to dine with the Mallorys, who were such
a lively couple, and Lincoln Noble, the black judge.  He had placed
them at table eight, which was as far from the entrance as possible,
for he wanted the maximum number of residents to become acquainted with
the newcomer.

When Betsy saw the size of the room and the large number of people
present, she lost her courage and signaled for Andy: "I've eaten in my
room or with a few family friends for months.  This is terrifying." But
he insisted that she come into the room: "I've reserved a seat for you
at the other side of the dining room."

"Why?"  she whispered nervously, and he said: "I want everyone to see
you.  To become easy with the fact that we have a new phenomenon in our
midst.  A girl who has been really wounded but who is going to make a
great comeback."  He pushed her chair among the tables, smiling to the
diners and occasionally stopping to say: This is Betsy Caw-thorn, of
Chattanooga.  She'll be walking among you in a short time."

When they reached table eight, Betsy's father, with the assistance of a
young waiter, lifted her into an ordinary chair between Mr.  Mallory
and Judge Noble.  Then the waiter quietly pushed the wheelchair back

to a spot at the entrance and left it there while Andy led Mr.
Cawthorn to a different table: "It's best, we find, if the newcomer
fits right in, on his or her own.  But why don't you join their table
for dessert?"

Betsy, left alone with strangers for the first time in four months and
overcome with embarrassment, could find nothing to say in response to
friendly questions except the monosyllabic yes and no.  The outgoing
octogenarian Mrs.  Mallory would not allow this to continue.

"Chris and I are going to have to eat and run because we have an
important engagement tonight," she said.  Then she smiled roguishly and
added:

"And can you guess what it is?"

Slowly Betsy allowed herself to be drawn into the guessing game but she
failed to find the proper answer.  Finally, she said: "All right, I
give up.  What are you going to do?"  When Mrs.  Mallory said: Take
part in a public dance in Tampa," Betsy's jaw dropped in disbelief.

"Yes, my dear, Chris and I love to dance.  Your man Yancey is so good
at his job that one of these nights we'll drag you along, and you'll be
dancing too."

The conversation became so interesting that Betsy was sorry to see the
couple depart, but that left her with the genial Judge Noble, who
invited her to join him one day at his fishing: "You'll see magnificent
birds standing beside you, no farther away than that next table."  When
she asked what kind of judge he was he said: "State judge, federal
judge, appeals court judge, retired judge," and he explained the
differences.

When Andy came to reclaim her at the end of the meal, she told him:

"I'm glad you made me come.  Everyone was wonderful."  So in a day of
many surprises Betsy Cawthorn was inserted into the normal operations
of the Palms.  After dinner she and her father visited the lounge to
introduce themselves, and two members of the Bridge Fanatics wanted to
know just one thing: "Do you play bridge, Miss Cawthorn?"

When she answered "Not yet," they laughed: "That's the correct answer,
because we'll teach you.  Are you what they call a quick study?"  and
her father answered for her: "At home we considered her a genius, and
it's good to think that she may get back onto the main track down
here."

Betsy spent the next day getting settled into her rooms, learning about
the Palms and making friends in the dining hall.  That night she sat
with Ms.  Oliphant and enjoyed the company of the former school
headmistress: "I wish I'd had a teacher like you.  I might have learned
more than I did."  With no touch of humor on her face except for a

twinkle in her eyes, Ms.  Oliphant said with a primness that
belied her words: "Yes, with me you damn well would have learned."

But she was even more taken with Reverend Quade, who seemed exactly
what a woman minister should be even though Betsy had never met one
before.

"I hope we can talk together one of these days.  You seem to have seen
so much of life.  Have you .. . ever known anyone crippled like me?"

"Worse.  In Pakistan I saw many young women who had suffered severe
physical damage whose fate was far worse than yours."

"How could that be?"

"They had no hope, none whatever.  Poverty and despair and perhaps
eventual suicide were all that was in store for them.  But you, my
dear, have a wonderfully supportive father, who can afford whatever is
necessary to help you lead a normal life, and our crazy man Yancey will
have you jumping about sooner than you can imagine'-she reached out to
press Betsy's hand-'you have so much to hope for."

Next morning after breakfast, Betsy was taken over to rehab, where
Bedford Yancey was waiting.  After she had dressed in an interesting
costume that consisted of a sleeveless top and denim shorts hemmed well
below the knee, he dropped to the floor next to her wheelchair and
asked his assistant to place her beside him.  She was instructed to
mimic him in every respect as he crawled around, taking sharp turns
from time to time.  Delighted by her agility, he cried out as she
passed him on her belly, elbows and knees: "You're completing the first
month's work.  We'll be dancin' by Thanksgivin'."

He also had her spend nearly half an hour seated at a machine that
encouraged her to strengthen her stomach muscles and particularly her
upper thighs.  At no moment did he force her beyond the point at which
she began to tire or show boredom, and after she had briefly tried two
other machines that would improve the power she might be able to
exercise through her knees, he cried: "Quits for the morning!  Let's go
out and watch the herons."  Placing her near her wheelchair, he held it
steady with his arms and feet and said: "Imagine there's a fire. You've
got to get out.  You're alone, but the chair is locked in park
position.

Can you possibly work your way into it?  Use any tricks you can think
of, but get into this damned chair."  And he watched her struggle, her
upturned face looking right into his, until he detected the moment when
she realized that all her strength, all her willpower was not going to
get her into that chair.  Saying nothing, giving her the merest bit of
help possible with his right hand, he enabled her to swing her left hip
into the chair.  When she was settled, he said: "I want you to feel the
exact amount of force I used to ease you over the last hump," and he
exerted against her outstretched hand less than a quarter pound of
energy: "You were so close, Betsy.  You almost had it done."

"Put me down again."

"You feel strong enough?  We've had a pretty lively workout, you
know."

"Just put me down," and again she struggled valiantly to work her left
hip into position, but failed.  He said nothing as he eased her back
into the chair, and she said: "I could feel the solution that time.
Couple of days from now, I bet I'll climb into this chair."  Noticing
that Dr.  Zorn had entered the room and had, presumably, seen her
double failure, she continued: "You be here, too, and you'll see me
vault into that chair."  He gravely replied: "With your determination
it's possible, I'm sure."

The two men wheeled her to a veranda from which they had a good view of
the pond to which, from time to time, water birds came that she could
not identify.  Later, Ms.  Oliphant came by and guessed that Betsy was
trying to identify the birds: "Could you maybe use a bit of help?

The little white ones, cattle egrets.  You'll often see them riding on
the necks of cattle, picking insects from behind the animal's ear.  The
big white ones, we don't see them too often, the white heron,
naturally.  We don't see any right now, but there's also the big blue
heron, a monstrous bird in comparison with the others.  The seagulls
I'm sure you know, and the big pelicans, wonderful comedians, they
never come to the pond.  They prefer the open water over there."

Later that afternoon Yancey introduced her to Dr.  Champion, the
prosthetist.  Yancey laughed: "Impossible to pronounce that word.  It
means the mechanical genius who will make and fit your prosthesis,
that's the technical word for your new legs.  I call him our orthopedic
mechanic, and he's one of the best.  When he makes your legs, they fit
and they work."  The frail, reticent man, not over thirty-five years
old, went immediately about his task, which was to record her body
measurements to determine what length and character her two mechanical
legs should have.  When he inspected her stumps prior to taking plaster
casts, he congratulated her: "You were well served by whoever handled
that part of the accident.  Now let's hope I can do as well," and the

manner in which he conducted his various investigations and
calculations gave some evidence that he would.  His major problems were
twofold: How long should the attachment legs be?  And how best to affix
them to the leg bones below the knee and attach them to the thighs
above?  He took numerous measurements, studied with micrometers the
photographs Mr.  Cawthorn had of her before the accident and came up
with practical estimates in each case.

They'll be properly weighted," he promised.

"Of that I can assure you.  And articulated, best in the business."

"Are we jumping the gun a bit?"  Betsy asked, and he laughed: "Mr.

Yancey said he wants to hurry this one along.  Says you're a prime
target for a sure, swift rehabilitation."  He smiled at her as she sat
in the sunlight coming in from the pool area and asked: "Would you like
to feel, right now, early in the game, how the fittings are going to
enclose the space below your knees?"

"Yes, I would, very much," and she pulled her shorts above the knees
and invited him to apply the fixtures.  When tightened, they felt snug,
and he pointed out: "And these don't even conform to your plaster
casts.  Miss Cawthorn, this is going to be a great adventure for you,
and I'll be proud to be a part of it."

She did not share his enthusiasm, for the curious structure he placed
on her right leg bore no relationship to anything human.  It consisted
of a big plastic cup into which her stump found a secure haven, but
below it stretched what she could only think of as part of a metal
skeleton, the bones of a leg without any kind of covering to make it
look like a leg.  The whole ended in a normal shoe, but bigger than any
she had ever worn: "That's to give stability," the prosthetist
explained.

The session ended with her thinking: I'll never adjust to anything as
ugly as that.  It will never be a part of me.

But the technician was a clever man, and as she left him he handed her
a big glossy magazine, Amputee Sportsmen.  When she went to bed she
started to leaf through it casually, but soon she was riveted by the
photographs.  Here was a handsome young man with one skeleton leg like
the one she'd seen, and he was driving a golf ball off the tee and
twisting his metal leg as easily as if it had been real.  On the next
page was a girl with her right leg missing above the knee playing
basketball and delivering a sharp pass to a teammate.  Amputees were
hunting, driving fast cars, casting for fish and working trained field
dogs.  It

seemed there was nothing they had to give up except perhaps
swimming.  She noticed that half had flesh-colored coverings over their
steel structures, half did not, and also that half had lost a leg above
the knee, the other half below.  Upon closer checking of the magazine
she made a sad discovery: there was no photograph of a sportsman with
both legs gone, and her euphoria evaporated.

That night she turned to her immediate problems, and she lay awake a
long time pondering the test she had failed that morning when she could
not edge her left hip into the chair, and the more she thought of the
problem, and analyzed the specific twists of her body she had failed to
make, the more she was overtaken by a strange sensation: as she began
to visualize every move she would have to make to climb into that
chair, and which signals she would have to send to muscles, bones and
ligaments, she could feel herself rising in the air and finding the
seat she sought.  And then, as she remembered the feel of the
mechanical devices that would be attached to her leg stumps, she could
almost will them to return to her stumps, and remain there with her new
legs attached.  She could feel what motions would be necessary for her
to climb out of bed and walk across the floor to the bathroom, and she
felt herself doing this without crutches or a four-footed walker or
cane.

Her rehabilitation started in those midnight moments as she visualized
her cure and made it a part of her psyche to be applied later in
governing her new legs and the newly strengthened muscles and ligaments
that would operate them.  Having enlisted her entire body and brain in
this exercise, she convinced herself that it could be achieved, and she
slept well.

In the morning she ate a light breakfast, telling her nurse: "Big job
today.  Don't want to be waterlogged."  At the training area she told
Yancey: "Help me get down on the floor and hold that chair, please."

Lying huddled on the floor, theoretically unable to do much about
anything, she looked up at Yancey, and he saw that with all her
energies under control, she was certain to work her way into the
chair.

But he told her: "Wait just a moment.  There's someone else who ought
to see your first triumph," and he called for Dr.  Zorn, who was eager
to join the watchers.

Pleased by his presence, she called: "Dr.  Zorn, you hold the chair
rigid."  When he and Yancey had the wheelchair immobile, she crawled
along the floor, directed her entire body to behave as she had
visualized

EXPLORATIONS

the night before and, almost as if lifted by some arcane power, she
rose in the air.  With no strain she edged her left hip a good two
inches higher than required for it to clear the arm, and with a grand
relaxation of her whole body she slipped easily into the chair.

"Bravo!"  Andy cried.

"Magnificent!"  and she said with some truth:

"Your being here gave me that extra strength."

Two successive rainy days in midsummer, a rarity, left the Palms in a
somber mood, so that when the tertulia assembled there was little
inclination to discuss anything of significance.  Raul Jimenez,
reminded of a day like this at a resort in the Colombian mountains,
said: "I was fifteen, just awakening to the world outside Medellin,
when the Spanish ambassador to Colombia came to the resort.  He was
such an imperious but impressive man, slim, erect, wearing an expensive
uniform laden with medals, that I saw in him the grandeur of his
homeland."

"What effect did this have on your thinking?"  Ambassador St.  Pres
asked.

"It made me realize for the first time that I was an heir to all the
greatness of Spain.  I was not only a loyal colombia no but also a
Spaniard whose roots went far back in the history of Iberia.  I was a
Spaniard, something to be proud of, and the discovery changed my
life-certainly my attitude toward life."

"Did you speak to the ambassador?"  St.  Pres asked, and Jimenez
gasped: "At fifteen?  Me go up and speak to an official like him?
Never!  I admired him from afar and made believe that someone like him
had been my great-great-grandfather back in Spain.  For me it was a
noble day, one when I suddenly saw everything in a different light. I'd
like to live it over again, that intensity of feeling.  As we grow
older we lose the capacity for such emotion, and it's a shame."

Senator Raborn, who had listened intently to Raul's story, said: "I
had a day like that, and it too was in the mountains.  When I was a
young officer I was stationed in Peshawar, now in Pakistan, at the
gateway to the Khyber Pass.  I was bitterly disappointed at not being

able to see the Khyber, even more famous then than now, but I was
never sent on the scouting expeditions that went into it because I was
detailed to a joint British-American exploring team that was visiting
three former provinces of the British Empire: Swat, Dir and Chitral.

What a fantastic adventure that was!  We traveled in little airplanes,
rickety helicopters and Land-Rovers that broke down on the ancient
mountain roads.  And the natives!  Their standard of living was like
that of people even before the time of Christ.  But what a glorious
experience it was to be there among the high mountains of the Hindu
Kush and the turbulent valley streams.

"We were in Chitral, talking to old-timers who had fought against the
British in the siege of 1895, and one of them told me: "We'd have
defeated the Englishmen if the Russians had given us the help they
promised," and in that moment I caught the full meaning of the struggle
that had been under way in these mountainous passes for the last two
thousand years.  It had been constant warfare."

"And especially during what came to be called the Great Game in the
1740s," St.  Pres said, 'when England held back repeated attempts by
Russia to burst through the mountains and capture India-' "Exactly!"
Raborn said.

"I suddenly saw it all, and that insight has determined my attitudes on
foreign policy ever since."  He smiled at Jimenez and concluded: "I'd
like to have a moment of insight like that right now.  To foresee
what's going to happen to the former Soviet empire.  Almost the same
kind of country.  Swat, Dir and Chitral."

In the lull that followed, the men looked first at St.  Pres and then
at President Armitage, but it was the ambassador who accepted the
challenge: "My story is nothing world-shaking but it's about an
emotional time for a seventeen-year-old at a summer resort on Long
Island.  There was going to be an end-of-season gala dance, and I was
hoping that a girl of heavenly beauty-her name was Rosamund-would agree
to be my date.  What dreams of glory I had!  But everybody else wanted
to invite her, too, so my chances were not good.  Then we heard that
she had accepted an invitation from a smoothie from Yale, twenty-two
years old with his own car, and we were heartbroken, me especially.

"But then what seemed a miracle happened.  She actually came over to
me-my heart was thumping, let me tell you-and said: "Richard, you're
one of my best friends.  I wonder if you'd do me a favor about the
dance on Saturday."  I thought she was going to ask me to take her,

and I must have turned purple, but she placed her hand on my arm
and said: "A cousin of mine is coming to town, and I wondered if you'd
be real sweet and take her to the dance?"

"I mumbled, "Yes," and the cousin turned out to be drab and homely and
while I was pushing her around the floor I could see Rosamund dancing
with the Yalie.  I was in agony."  He shook his head and said: "I'd
like to have another summer like that, when everything was lived at
such an intense level.  Incidentally, years later I saw Rosamund and
her cousin at the same summer resort, and Rosamund had gained weight
and looked dumpy, but the cousin had matured into a lovely woman."  He
banged on the table with his fist and repeated: "The intensity!  The
years pass and we lose the intensity!  It's the same in politics.  I'm
ashamed to say that in the last election I didn't really care who won,
Bush or Clinton."

"Whom did you vote for?"  Raborn asked, and St.  Pres said: "Bush.  I
liked Barbara better than I did Hillary."

Henry Armitage, while listening to his friends reminisce and wondering
what he could talk about that would be at all interesting, looked out
the window at the rain and was swept back to another rainy day in
Hartford, Connecticut: "I'd had my Ph.D. for three years and had taught
at a big public university, so I was doing well.  On a day much like
this I applied for a major job at Trinity College, one of the best in
America.  In those days to get a job in Hartford was about as high as I
could hope for.  I reported to the building where the faculty committee
was interviewing young scholars from the top universities.

There were four faculty members on one side of the table and me alone
on the other.  When they started to question me, I seemed to become
paralyzed.  All the fine things I could have said about myself, like
the fact that I was a serious scholar, ended as mumbled yes-no
responses. When I left the interview I knew I had blown it.  The letter
saying I was out of the running for the job arrived three days later.

They didn't waste time on niceties."

"Why was it so important?"  Jimenez asked.

"I've taught at six different American colleges, and if you're a bright
student with a fine professor, one school's as good as any other.  Of
course, the chances of getting a great professor at Chicago or North
Carolina are better than average, but I'm not sure it makes much
difference."

"Oh, it did to me!  If I'd won that professorship at Trinity, I'd

probably have remained in that circle of powerful private
colleges and universities all my life.  And ultimately I suppose I'd
have been president of one of them.  Failing to gain entrance into that
charmed circle at that point, I was branded as being good enough only
for big public institutions and I've always resented the
classification.  It was wrong, and I brought it on myself."

Senator Raborn sniffed at this confession: "You mean you hold schools
like Wisconsin and Texas in contempt?"

"No, no!  You can get a fine education in any of them.  It's just that
I had hoped to spend my teaching years in one of the more rigorous
schools."

"Are you essentially a rigorous educator?"  Raborn asked, and Armitage
replied, in a low confessional voice: "I realize now that I wasn't
really as rigorous as I thought.  Had I been I'd have nailed down that
Trinity job.  And when I didn't get it, I could have gone home and
written the scholarly studies I had in mind.  Had I been powerfully
self-motivated I could have written my books in South Podunk State
Teachers College."  He stopped, fearing that he was revealing too much,
then added: "But I was a good administrator.  I found my level and even
became a president, as I had hoped, but not at one of the great
schools, the prestigious ones."

The rain continued.  The men fell silent, each recalling significant
moments in the past, until Jimenez surprised the others by saying: "I
wonder if women have such regrets."  He suggested that the senator
invite his wife and Senora Jimenez to join them while he signaled to
Reverend Quade that she too should draw up a chair.

They were now a group of seven, filling the corner of the room, and
Raiil explained: "We were reminiscing about old times-about special
moments when we were young men and saw things so clearly and felt so
intensely."

Raborn broke in: "And we were regretting that we no longer had such
moments.  Do you girls-' "Stop right there, Stanley," Reverend Quade
said.

"We do not use the word girls any longer to indicate mature women-'
Mrs.  Raborn interrupted: "And we certainly are mature."

"You're acting like girls right now," Raborn said.

"Men call each other boys from time to time."

"But you men determine who is given respect," Mrs.  Quade said.

"You can call each other boy and not lose status.  We have to
fight for status."

Raul banged on the table and spoke harshly: "Ladies-' "You can't use
that anymore, either," the Reverend said.

"It's condescending.  The only phrase in which it's allowable to use
lady is "lady mud-wrestlers."  For the rest, use women."

Jimenez was not deterred: "You muchachas often ask why we muchachos
meet together in our corner.  No ladies allowed usually.  It's because
we can conduct a serious conversation with an implied set of rules.
Argue the idea, not the personality.  Pause frequently so the other man
can jump in.  And control your temper.  You muchachas disrupt orderly
discourse, make it impossible."

"Say what you were going to say, Raul."

"You've ruined the ambience.  Wouldn't make any sense now."

"Raul!"  his wife cried.

"You're being petulant.  Now just carry on like a good little boy."

When he proved unable to do so, for the spirit of the discussion had
been shattered for him, President Armitage took over: The rainy day
reminded Raul of an experience in Colombia, when he saw for the first
time the imperial dignity of Spain in the shape of the Spanish
ambassador with his medals.  He was sixteen at the time, if I
remember."

"Fifteen," Raul said.

"It was an explosive moment.  Spain became a real place to me, home of
my ancestors."

"Stanley had his flash of insight in the Himalayas.  Saw the great
battle of wills between Russia and England."

"In the church," Mrs.  Quade said, 'we call such moments "epiphanies,"
when the vision of Christ or the godhead becomes clear.

In the nature of my work I've had several.  The first was when I saw
that women could become priests, that this woman could do it.  And the
second when I saw that neither this woman nor any other in our day was
going to get very far, even if we did get in."

This observation was so personal that none of the men wished to
comment, so Mrs.  Raborn said: "I had a true epiphany.  Raised in a
liberal eastern family, I began to fall in love with this western
cowboy here, as conservative as they come, and I appreciated the pickle
I was in.

Stanley and my father had violent arguments and, with more gentility,
so did my mother and Stan.  All three of us considered him quite
hopeless, but one day my mother made a simple observation: "I'll say

this for your Neanderthal, Marcia.  Sometimes in the kitchen it's
better to have a bristly scrub brush than a limp dishrag.  Your young
man has the courage to say what he thinks," and in a flash it became
clear.  Better a hardhitting, hard-working conservative than a liberal
wimp who vaguely wants to get things done.  On the basis of my mother's
comment, I married this bristly cowboy and have never regretted it."

Senora Jimenez said, in her excitable way: "I had a vision, but it came
late.  When Raul received so many death threats that getting out of
Colombia seemed the only sensible thing for him to do, I faced a
terrible problem.  I came from a large family, so many aunts and
uncles, people of substance, important people, some of them.  I did not
want to leave all my friends, my family.  But one day as I looked at
Raul in our garden in Bogota, the sun shone on him in a certain way and
I saw him as something bigger than I had realized, and the thought came
to me:

This one is worth keeping alive, and that week we flew to safety in
your country."  Deeply moved by this recollection, she seemed about to
break into tears: "Now we are alone, no aunts and nieces, but we are
free and we are alive."

No one spoke, then Raul said: "When people move into the Palms they
spend the first period as new arrivals, listening and learning.  Then,
when we feel safe and feel at ease, we engage in an exploration of our
own ideas and those of others.  That's the stage we're in now.  That's
why we talk so much.  And then, gradually, subtly, without ever being
aware of it, we prepare ourselves mentally and emotionally to make our
departures.  It's on rainy nights like this, when the air and the world
are heavy, that we see the progression so clearly.  I like your word,
Helen.  Epiphany, the moment when we see things."

Muley Duggan took delight in telling a mixed audience at the Palms:

The two sorriest days in a man's life in this joint is when his wife
dies and when he has to give up his driver's license.  Not necessarily
in that order."  When Dr.  Zorn asked why men of good judgment made
such a fuss about surrendering their driver's license, Krenek
explained:

"When you're here awhile you'll get used to the trauma men experience

when that fateful day arrives.  In their early eighties they
begin to wonder: Should I quit driving?  And if their wives cry out at
a traffic light: "You drove right through that red light.  You'll get
us killed!"

they resent her interference, but when they're off by themselves they
admit: That was a near one!  and they begin to think seriously about
giving up driving.  Some of our men have told me that's how it
works."

"Who makes the decision?"  Zorn asked.

"Us?  The wife?  The doctors?

Or is there a government agency that tracks these things?"

"For sure we don't.  We'd have a revolution on our hands.  And the
government is very lax.  None of their people want the hassle, so the
old folks keep driving until you read about it in the paper: WOMAN

EIGHTY-SEVEN

KILLS THREE ON SIDEWALK."

"Well, somebody makes the decision."

"It's cumulative.  A close call-the wife says nothing at the time.

Later she points out to her husband that a friend on the first floor
has given up driving.  The husband makes no response.  Then somebody on
the second floor surrenders her license.  The husband still refuses to
follow suit.  So the next week he has a real close call, and the wife
comes to me: "Please beg him to stop driving," and I have to do it.

"From here on it'll be your duty.  It'll be tough, and when you find
you're having no success, you have to quietly inform the medic that the
old man has about had it.  And the doctor will try to convince him that
the old eyes and reflexes just aren't up to driving.  If he still won't
budge, you have to call the Florida Driver's License Division (you can
do it anonymously), and they'll launch an investigation.  And then the
anguish begins."

"Is it that bad?"

"Andy, if you told me right now that I couldn't drive any longer, I do
believe I'd go nuts.  I'd feel my manhood had been attacked.  The force
that keeps me going would have been depreciated.  I'm damned if I know
what I'd do."

"But you're just in your early fifties.  To you it would be
important."

"When I'm in my eighties it will be twice as important.  At that time
things are slowing down.  A muscle here, a tooth there, stronger
glasses.

And there's the overriding knowledge that death is growing closer.  Our
old men, God bless 'em, they never admit that, and hiding it is also a
burden.  Judicious men don't brood about death, but it does creep into
their thoughts.  Especially when the obituary page contains ten men
in

their sixties or seventies: My God!  I'm fifteen years older than
those guys, they think.  And then comes the inescapable shock, an
outside judgment that can't be ignored.  The license taken away. That's
too much to bear."

Andy smiled at his assistant: They taught you something at NYU.

You planning to write a book?"

The men here write it for us, every week."

"Looks as if we may have to crank up the machinery to persuade Chris
Mallory to give up his license.  Several people have complained to me
about his driving."

The dancing man!  It'd kill him, he's so proud of his ability to keep
going."

"What do you recommend?"

"Let me ask around.  Has his wife spoken to you?"

"No.  She seems to be the kind that would rally around to defend her
husband."

"What kind of car does he drive?  That sometimes makes a difference.

I've noticed that a man will surrender his Ford but fight like a fiend
to keep his Cadillac."  His prediction proved accurate, for when Andy
took Mrs.  Mallory aside and asked: "Do you think the time may be
coming when Chris should consider stopping driving?  He is ninety, you
know," she replied: "He'll want to drive our cars as long as he can use
his legs to work the brakes.  Besides, I'm eighty-seven and I can drive
now as well as I ever did.  So forget it."  Since Andy knew her to be
what his mother had called 'a well-bred lady," he recognized that in
rebuffing him so forcefully she must have thought his inquiry was
either intrusive or insulting, and he expected no help from her.

A few days later, however, while Mr.  Mallory and his wife were driving
back from the mall on Route 41, he made a last-minute left turn onto
117th Street that forced a traffic cop coming the other way to veer
sharply to his left to avoid hitting the Cadillac.  This sudden swing
placed the officer in jeopardy from cars coming in the other direction,
because it thrust him into their lanes.  Only his skilled driving
enabled him to avoid a crash, and when he was able to turn around and
pursue the Cadillac, Mr.  Mallory was carefully parking it at the
Palms, unaware, like his wife, that he had done anything wrong.

The officer overtook the Mallorys just as they were about to walk into
Gateways, and when he saw how old they were he refrained from

yelling at them.  Quietly he asked: "Sir, may I please see your
driver's license?"  Chris, who took pride in always carrying it in a
special leather case, presented it with the innocent question "Did I do
something wrong?"  and the officer was astounded to see that neither
Chris nor his wife realized how close they had been to causing a major
pileup.

"I think we'd better step inside," the officer said, and as the three
entered the reception area Mr.  Mallory asked in true bewilderment:

"What's this about?"  and the officer said: "I think we'd better speak
to the manager."

When they were in Dr.  Zorn's office, the policeman said very
carefully: "I'm afraid, Doctor, that your man here ought to be warned
against driving-at his age.  How old is he?"  and Mrs.  Mallory
snapped: "Ninety and perfectly competent."

"We can let the License Division decide that."

"You mean, you're arresting him?"  Mrs.  Mallory asked.

"He did nothing wrong."

"He made a left turn off Route 41 that drove me into the oncoming
traffic.  Could have been a huge smashup."

"You must have been driving carelessly," she said, for she was sure
that he was lying.

"Doctor, it would be easiest if you can persuade this gentleman to
surrender his driver's license without me having to alert the License
Division to launch an investigation.  As a favor to everyone, I'll be
back tomorrow to, I hope, pick it up."

When Dr.  Zorn was left alone with the Mallorys he observed that Mr.
Mallory, abetted vigorously by his wife, was not going to surrender his
license: "Unthinkable!  I'm as good a driver as I ever was," and his
wife agreed.

So Zorn, rather cravenly he knew, turned the matter over to Mr.

Krenek, who was certain that the traffic cop had made a proper
intervention, one that could in the long run save lives: "Mr.  Mallory,
it really is time you considered seriously turning in your license.
Many men have to face that decision.  Your friends know that your
reflexes, and maybe your eyes too, have slowed down.  It's for his
sake, Mrs.

Mallory, please help us convince him."  When she dismissed that
suggestion with a wave of her hand, he called Dr.  Zorn on the phone:

"Did the officer say he'd be back tomorrow?  Well, that sort of solves
it, doesn't it?"

Mrs.  Mallory, who could deduce the tenor of Zorn's reply, said: "It
solves nothing.  That officer can't simply take Chris's license, not
without a full investigation, which Chris would pass with flying
colors."

Krenek attacked the problem with a tactic that had proved helpful in
other cases.  He invited two other couples whose husbands had been
forced to give up their licenses.  Both of the men were much younger
than Mallory, so that when they testified that it had been the proper
decision he had to listen, and the wives assured Esther Mallory that
she would not regret what all four of them now knew-that it had been
the proper decision.

That night Andy saw that Mr.  Mallory was listless at dinner and that
he walked with a slow tread and downcast eyes as he left the dining
area.  What Zorn could not see was that when the former executive
reached his quarters, he took from his safety pocket his leather case
with its driver's license and placed it on a table where he could see
it.

That night he did not watch the MacNeil/Lehrer Newshour and the eleven
o'clock news, and when he went off to bed he mumbled: "When you grow
old, they do cruel things to you."

Surprisingly soon after he had taken careful measurements, the
orthopedic technician was back with a pair of temporary legs for Betsy.
Each consisted of three parts.  At the top was the plastic socket into
which the stump would fit: "It'll fit more precisely next week after we
take casts of your stumps, but it's already close enough to get you
started."  At the bottom was a large, flat-soled shoe.  And in the
middle came the more important part, the mechanical leg itself, and
this would be permanent, regardless of what form the perfected socket
took.

"This is the heart of your recovery, just the raw metal substructure
for the moment.  The imitation flesh to enclose it and make it look
like a leg comes only when we're sure everything's working."  The
mechanic adjusted the fitting of the remarkable skeleton leg to the
socket and explained its marvels: "It's called a Blatchford Leg, after
the company in England that makes them.  It doesn't weigh much, but it
contains a score of control points that enable you to do almost
everything you did before.  The bottom will last

you a lifetime, but the upper socket changes month by month, year by
year, as your leg and its stump change."

While Betsy was fitting this new companion to the remnants of her leg,
Yancey left the room and returned with the couple that Betsy had dined
with that first night, the dancing Mallorys.  She supposed that they
had come to watch, but that was not the case, for Yancey announced: The
Mallorys volunteered to bring some friends they met at the dances in
town."  Mrs.  Mallory signaled in the direction of the door, whereupon
a fine-looking, athletic, gray-haired woman in her fifties appeared,
took Mr.  Mallory by the arm, and as a pair they executed a series of
professional-quality dance routines.

Betsy was bewildered, could make no sense of such an exhibition, until
the woman suddenly stopped, held on to Mr.  Mallory's arm, pulled up
her skirt and showed that she had one mechanical leg, which she could
move about as if it were actually flesh and bone.

"We wanted you to see what can be done," Yancey explained.

"But she has one good leg," Betsy pointed out, and Yancey said: "But
this one hasn't," and he signaled for Mr.  Mallory to bring in a marine
veteran he and his wife had also met on their dancing outings.  He was
in his early forties, a lean, tough-muscled man who walked up to the
grayhaired dancer, took her by the hands and swung her into position
beside him so they could do a soft-shoe routine as he whistled the old
tune "While Strolling Through the Park One Day."  At the end of their
performance he reached down and pulled two zippers at the bottom of his
trousers to reveal two Blatchford legs, exact duplicates of the ones
leaning beside Betsy's chair.

The marine, a likable man from the New Orleans area, came over to
Betsy's chair: "I was hit by a land mine in Vietnam.  Thought I'd never
walk again, let alone dance and play basketball, but you can see I made
it."

"What was your secret?"  Betsy asked, for her intellectual adventure
with climbing into the chair had convinced her that her recovery was
primarily a matter of using her brain to direct her body to perform in
new ways, and the marine confirmed this.

"You got to believe you can do it, and you have to visualize yourself
doing it.  And in the first weeks when you fall down, you have to get
right back up and do it correctly."

"Do you go around demonstrating what you can do?"  Betsy asked and he
said: "Yes, I work for the Veterans Administration.  I earn a fair
living and I have a great time showing others.  That's how I met Mr.

Mallory."

"Do you and your team ever fail?"

"One in twenty, maybe.  But the losers have convinced themselves before
we ever get to them they'll never be able to do it, and they refuse to
walk, just to prove they were right.  We think it may be a
psychological fixation that imprisons them in the first hours after the
incident.  It's so powerful it can't be overcome, so we too are
powerless."  He looked at Betsy, squeezed her shoulder and said: "They
tell me you don't have any of those mental negatives."

"For four months I did."

"Oh my God!  You wasted all that time?"

"I had to collect myself... get the pieces together.  Now I'm a free
woman ready for the job."

"Ma'am, may I kiss your hand?"  and as he did he whispered: "The
fight's nine-tenths won.  I'll be back in three months and then it's
you and me doing the dancing."  He stepped back and bowed formally:

"Now, Miss Tennessee, do you want to try on your new legs, and
make-believe walk with me so you get the proper mental pictures right
at the start?"  She looked at Yancey and the prosthetist and they
nodded.

So for the first time in her new life, Betsy had her new legs fitted
snugly to her stumps, and when she had worked her thighs back and forth
to adjust what seemed like tremendous lumps immobilizing her legs, she
indicated to Yancey that she was ready to try standing.  But he
cried:

"You're not going to stand.  We're going to hold you six inches off the
floor, and you're to imagine you're standing.  Nurse Nora, fetch that
big mirror," and when this was done the men held Betsy aloft and moved
her about, feet clear of the floor, as if she were walking.  In the
mirror she could see that her new feet looked like feet, shod in
sensible shoes.

But then the experiment fell apart, for as she tried to move her legs
they did not respond, and Yancey and the marine felt her go limp in
their arms, so they quickly set her down.  The men were afraid she
might have been near fainting, but Nora said reassuringly: "This one
won't faint.  What's the matter, little queen?"

"I could not feel them.  They were not a part of me.  It was
frightening," but Yancey reassured her: "It often happens that way. But
they were a part of you, and I'll prove it.  Stand up again," and he
and the marine brought her to her feet as he shouted across rehab to a
newcomer to the room: "Dr.  Zorn!  Just in time to take my place. Help
hold her up, I have to kneel."  When Zorn came over to his star patient
and placed his right arm firmly about her waist, everyone could see
that now she felt secure.

Then Yancey, on the floor and taking control of her right foot, began
tapping it on the floor while the left dangled, and soon he was
hammering the right foot down against the floor and mumbling in time to
the rhythm of The Blue Danube."  Finally he started shouting: This foot
belongs to Miss Betsy Cawthorn.  It is the right foot of Miss Betsy,
and it's a damned good foot."

When he rose, he stood before Betsy as he told the two men holding her
to relax their grip ever so slightly ... more ... more ... more until
at last they were holding her upright merely with their fingertips,
while Yancey remained alert to catch her if she should fall.  When she
was for all practical purposes standing alone, he gave her a tremendous
smile that filled his face and ran up to his red hair: "Now, Miss
Betsy, does that foot belong to you?  Is it attached to the rest of
your body in any way?

Are you now standing on it, full weight?  Could you, just perhaps, move
it forward, just an inch or so?"  When she did, he gave her a huge hug,
banged her right leg smartly just above the knee and announced to the
hall: This right leg now belongs to Miss Betsy Cawthorn, but we aren't
sure about the left one.  We'll test it tomorrow."  And Dr.  Zorn,
keeping his arm around her, lifted her back into her chair.

Yancey, the prosthetist, Betsy, Nora, Dr.  Zorn, the Mallorys, their
visiting marine and the woman with one leg missing had lunch together
in Zorn's office, and the talk was exclusively on the problems of
rehabilitation in which prosthetic devices were used.  The prosthetist
said that he had studied with the great Dr.  Rusk in New York, from
whom he had learned that there was no movable external part of the
human body that could not be replaced by a mechanical device if it was
properly engineered, fitted and intelligently introduced to the user:
"Providing always that the patient is intelligent enough to appreciate
what he is getting and how to adjust to it."

"Even knees?"  Betsy asked, and the man said: "Yes.  Not right now, but
very soon we'll have a knee that can twist and turn in every way a
natural one can.  Hips we have, fingers, wrists, and wonderful arms
with articulated hands and fingers.  And my experience has been that
ten years from now, Miss Betsy, you'll have a pair of new-generation
legs that will let you perform even more miracles."

"Why can't I have them now?"  and he said: "Because it takes geniuses,
teams of them, working day and night for a decade to develop the next
level of equipment.  Right now we're down here six inches off the
floor.  In twenty years we'll be up there near the ceiling.  Miss
Betsy, before you die you'll have legs that operate electronically on
thought messages relayed from your brain to your thighs and knees,
instructing them what to do next.  Of that I'm sure."

When the lunch ended after its lively exchange of ideas, the others
departed, but Betsy stayed behind to talk further with Zorn: "I was
surprised to see what you looked like when I arrived.  I remembered you
as a miracle man who had saved my life, but had no recollection at all
of what you looked like.  I wasn't even sure you were real."

Andy said, rather clumsily: "Same with me.  You were a girl with
mangled legs.  I paid more attention to them than I did your face."

Hesitantly he added: "You're quite beautiful, you know."

She blushed and changed the subject.

"You have a splendid place here.  Rooms are pleasant, food's pretty
good and the atmosphere is great.  You should be proud."

"Are you finding rehabilitation tedious?  Yancey can be pretty
relentless."

"I'm finding it frustrating, to be honest, but not because of him.  I
enjoy his toughness.  Brings me down to reality.  But I used to be a
really good tennis player, nowhere near top-drawer but I could smash
that ball and run after shots.  Now that will never again be possible."
Andy could see she was feeling sorry for herself, so he said something
that would later amaze him: "I think most of us face tremendous defeat
at some point in our lives.  You've lost the ability to chase tennis
balls.  I lost my entire profession," and he confided in her how dismal
he had felt when he lost his clinic, his job and his place in the
medical life of Chicago.

When he finished, they sat in silence for some time, he on one side of
the table, she on the other.  After their talk, a new and quite
different bond seemed to bind them together, two wounded people, each
in need of rehabilitation.

For Betsy, Dr.  Zorn's active part in her rehabilitation made a
tremendous difference.  In her drab surroundings and unimaginative
therapy in Chattanooga, there had been none of the uplifting promises
she heard in the Palms, no agile fellow amputees to inspire her, and no
one with the enthusiastic supportive ness of Bedford Yancey, Nora and
now Dr.  Zorn.  When it had been decided in Chattanooga that in
obedience to her wishes she would be brought down to Florida and Dr.

Zorn's care, she had not dared to hope that he would take a personal
interest in her recovery.  That he would be in charge would be
enough.

Now that he had shown a deep interest in her care, she felt sure that
her recovery would be quick and complete.

That afternoon she asked to be taken again to Rehab, where she asked to
have her legs attached to her stumps.  When they were in place, with
Yancey looking on, she used two hands to grab her right leg and jerk it
up and down, roughly, so that her new shoe could tap on the floor, and
when she had done this for some minutes, smiling at the results, she
shifted to her left leg, repeating the process, and after a thorough
test she looked approvingly at Yancey and said: "It seems to belong,
too, and now if you please, Maestro, a few bars of that waltz again,"
and while he hummed "The Blue Danube' she shifted from thigh to thigh,
tapping her new shoes and even roughly keeping time to the music.

One day Dr.  Zorn was helping a newly arrived widow from Vermont move
her furniture into one of the single-bedroom units on floor three of
Gateways.  While he was shifting pieces around in one room he overheard
a young fellow from the trucking company ask an older man: "Who lives
in these rooms?  They must cost a bundle!"  and the answer was "A bunch
of used-up old geezers who sit around waiting to die."

Andy did not rebuke the man but he was irritated by several of the
words he had used that were grossly inappropriate: "Used-up?  The
people I see are brimming with energy and enthusiasm.  Look at Judge
Noble.  Old?  The four men who sit around that table arguing certainly
don't think of themselves as old, nor are they.  Waiting to die?  The
ones I know are too busy living and participating in life to waste
their time brooding about death-those like Reverend Quade and her
counseling work, and our women who volunteer to work with the people in
Extended Care."

All this led him to ponder a phenomenon that had been brought to his
attention by Nurse Varney: "Boss, have you ever noticed how many of our
people who finally die are written up in The New York Times because
they made such important contributions?"  And when she helped him
compile a list he was astounded at its richness.  Inspired by the three
most recent clippings, he sat at his typewriter and dashed off a
message for inclusion in the next edition of Palm Fronds, a newsletter
he had initiated:

Have you noticed how many famous Americans have shared quarters with
you at the Palms?  The other day I listed the names of our former
residents who, when they died, were written up in The New York Times
because of their notable contributions to our national life.

Tampa is a long way from New York, but our men and women were not
parochial.  They had been citizens of the entire nation and were so
remembered.  When you read this impressive list of important people who
lived among us, bear in mind that among those who live with us now are
others who are just as important.  We are not a bunch of has-be ens or
never-we res

You'll read about us in the Times.

Then followed a list of eleven onetime residents whose obituaries
recounted the worthy contributions they had made, including a woman who
had been a noteworthy missionary in Africa; a painter whose works had
been widely shown; a general with many medals; a businessman whose
operations had covered a dozen states; a newspaper editor who had
fought the good fights and won two Pulitzers for doing so.

On the day Palm Fronds appeared in each mailbox, the four members of
the tertulia could hardly wait for the evening meal for a discussion of
the matter.  Raiil Jimenez remonstrated as soon as he was seated:

"The death of former residents is hardly a topic to be discussed at
dinner," but the others disagreed, all talking at once.  Ambassador St.
Pres voiced the consensus: "Although it does have a touch of morbidity
that's discounted by the lift to the spirits of those who live here.

Maybe some of us are worth remembering."

That led to a discussion of what criteria the Times probably used in
deciding which deaths to memorialize and how much space to accord each.
The men also wanted to know why certain obituaries started on the front
page and carried over, while others did not-as, for example, Margaret
Mead on front page, full page later; Edward Land full page later but no
front page.  Here Jimenez volunteered a suggestion: "Dr.

Mead dealt with ideas, Land only with things.  His invention of the
Polaroid camera was a contribution, but a limited one.  Her probing
into primitive societies enlightened us all."  The men concluded that
an editorial board probably adjudicated placement along the lines
suggested by Jimenez.

Then they moved on to a somewhat macabre game: "Suppose that the four
of us were in an airplane that crashed.  Whose name would be featured
in the headlines next day?"  It was a silly game but it had the virtue
of driving each player back to fundamentals: "What is a noteworthy
life?  How are men and women judged?  Does a person have to stand for
some one thing if he or she is to be noticed?  Does where a person
lives or operates make the difference?"  The factors that led to an
overall evaluation of worth seemed endless, but they were not trivial;
moral, social and political priorities had to be established and
defended.

President Armitage, who had been accustomed to adjudicating the
competing claims of his faculty members, suggested: "Let's take locus
first.  Senator Raborn was a nationwide figure of some importance.

Ambassador St.  Pres worked in the international field, so that many
Americans might not even have heard his name, whereas foreigners were
familiar with him.  Jimenez was certainly known worldwide because of
the ugly plight in which he was trapped.  The two institutions I led
were not equivalent to Harvard or Stanford, but they did play a
significant role on the national stage.  I'd not want to make the
judgment, but if I had to, I'd incline slightly to the senator."

Raborn demurred instantly: "Like you, Henry, I was no Borah or
Vandenberg, but I was a reliable workman."  St.  Pres made a strong
point: "When the question was posed you didn't specify what newspaper's
headlines we were talking about.  I would suppose that each of us would
have exercised considerable influence in our own communities.

In Miami, for example, I'd guess that they'd feature Jimenez because of
his importance in the Latin countries."  Jimenez would have none of
this:

"Come on, we were talking about The New York Times, the best national
paper.  Let's keep the discussion focused," and St.  Pres made a
profound observation: "It would depend, I think, on two things.  The
mood that day of the editors making the decision-"We've had too many
women recently"; "I'm fed up with the arrogance of scientists";

"Who the hell ever heard of Bismarck, North Dakota?"; and, equally
important, "What kind of picture of the Times do we want to project?"
If they presume to be the national paper, as Raul just said, they must
show a national stance-or in my case, an international one.  On those
criteria I honestly believe any one of us might be eligible, depending
on the mood of the board on the day after our plane crashed."

St.  Pres went on to make an interesting point: "I'd say it would have
to be Raborn because of the role he played in national life, except for
one factor.  There are one hundred senators and it's pretty hard to
stand out in that mass.  Suppose our friend President Armitage had
performed some miracle that made him really stand out among the
thousand college presidents.  He might be the one chosen."

Now it was Armitage's turn to broaden the definitions: "But good old
St.  Pres, working anonymously in one foreign country after another,
is, as he intimated, a roving nobody.  Except'-he slammed the table so
hard that the glassware rattled-'in Zambia that time he did stand up to
the rabble that wanted to burn our embassy and he did lead eleven of
our people right through the middle of the mob, daring them to touch
him.  Anonymous no more."

At this point Raul Jimenez played his favorite role, that of the
detached philosopher: "Gentlemen, let's not be so parochial.  We four
aren't the acme of this place.  The sun doesn't rise and set with us
alone.

Let's suppose everyone in our part of the Palms was in that plane that
crashes.  Some of those big planes could handle us all.  Who, then, is
noticed in the headlines?"

It was a good question, because the four men who constituted the
tertulia had imperceptibly and justifiably come to think of themselves
as the intellectual elite, but they were never arrogant about it, and
Jimenez's reminder that there might be others at the Palms who, if
their plane went down, might be deemed more memorable was quickly and
easily conceded.  But when they tried to visualize their fellow
residents and identify who among them might be newsworthy, they drew a
blank.  There was no one.

Then slowly St.  Pres, who had a remarkably solid approach to life,
considering that he was from the State Department, began to think
aloud: "Always bearing in mind that the Times would be jealous of
protecting its ecumenical reputation, it occurs to me that they might
find Reverend Quade our bellwether.  She was one of the first women to
be ordained as a full-fledged church leader.  She led the fight for the
true basic rights to which women were entitled, not the flashy right to
enter a poolroom or a private club or a locker room where male football
players take their showers.  Dignity, perseverance, accomplishment,
that's a heady mix, and if I were in charge of the obituary page it
might capture my attention."

As the men thought about this Senator Raborn snapped his fingers: "I
completely forgot.  We're overlooking our most prominent member."

When the others looked surprised, he said: "When I was in the Senate we
were approached by a group of scientists who asked us to memorialize
the Nobel Prize Committee in Sweden to consider the claims of Maxim
Lewandowski in science.  Yes, our propeller wizard, our rumpled
beanpole whose wife cuts his hair with a bowl was judged to be our
prime candidate that year, and my staff helped draft the memorandum we
forwarded to the committee."

"What came of it?"

"Obviously he didn't get the prize and I've often wondered why."

"Let's ask him," the pragmatic Armitage said, and next night at dinner
the tertulia entertained their cohort Maxim Lewandowski as their
guest.

It was easy for Senator Raborn to open what would have to be an
intrusive interrogation: "Max, when I was in the Senate, if my memory
does not play me false, my staff put together a memorandum in your
behalf, which the full Senate forwarded to the Nobel people in
Stockholm recommending you as recipient of the prize in some branch of
science, I forget which.  Do I remember correctly?"

Each of the men leaned forward to watch how the gawky man would respond
to this surprising probe into an affair long dead.  To their surprise
the old man, now eighty-six, leaned back, clapped his hands gently and
smiled: "Well, now!"

"It's true?"  St.  Pres asked, and the scientist replied: "I believe
numerous leaders, from various fields, nominated me.  The Senate
committee, yes, and strongly."

That's right," Raborn said.

"Eight or nine leading senators signed the recommendation with me. What
happened?"

Lewandowski closed his eyes and recalled the most painful moments of
his life.

"Genetics made me, literally and figuratively, but it also destroyed
me."  To help the others understand the terrible trap into which he had
fallen, he started with simple basics: "I'm sure we all know what role
the many millions of genes each of us is endowed with play in human
existence.  They're the incredibly small, magical units that determine
how we shall look, what color hair we have, our bone and tooth
structure, our resistance to disease and, some think, our intellectual
capacity; even when our biological clock will begin to run down and
when death will follow is probably destined at our conception in the
womb."

The men asked about such things as genetic inheritance of
characteristics, diseases that result from errors in the genetic
inheritance and other aspects of the mystery.  He handled all the
questions patiently and with a marked skill for simplification and
generalization.  But after many minutes he waved his hands across the
table as if he were clearing it and asked in quite a different tone of
voice:

"We've talked a lot about genes, several million in a human body, but
we haven't said how they exist or how they do their work.  Well, the
genes are on the chromosomes.  Each chromosome is a threadlike filament
incredibly long and incredibly thin.  It's made of DNA, one of the life
directing substances.  There are twenty-two chromosomes in every human
being, and since each one consists of two strands, one from the mother,
one from the father, we carry with us a total of forty-four. The pairs
are numbered from one, rather large, to twenty-two, quite small, and
through a process of isolating, staining and magnification we can
actually photograph them."

"Where does the stuff come from that can be photographed?"  St.  Pres
asked, and Lewandowsi gave an astonishing answer: "Any body fluid.

Blood, of course, but also perspiration or sputum or urine, or just
about anything else."

Lewandowski expanded further: "In addition to the twenty-two chromosome
pairs, which might be called the traditional ones, there's another
pair, mysterious, outside the mainstream.  It has no number but

it's all-important, because it controls human sexuality.  If this
special chromosome pair has one component X and a second X-and they too
can be photographed-the baby turns out to be a female.  But if it
consists of X and Y, it's a boy.  And across the world, in all
civilizations, for every one hundred girl babies born, there are around
one hundred and four boy babies.  Have to be, because boys are more
fragile than girls.

They die off easier.  I forget the actual figure, but at about eight or
nine, the balance is an even one hundred girls to one hundred boys, but
thereafter it quickly falls into an imbalance and remains that way all
our lives.  There're always more females than males."

"I'm guessing," said St.  Pres, 'that somehow you messed up with this
mysterious twenty-third chromosome pair."

"Close, but not quite.  You see, in a constant minority of XY cases the
poor fellow has a double Y. He's XYY, and right there my trouble
began."

"Why?  What does XYY produce?"  Raborn asked, and the scientist lowered
his head, bringing his hands to his lips as if what he now had to say
was too painful to share.  Then, straightening his shoulders he
coughed, looked at the members of the tertulia and said in a burst of
confidence: "I did most of the original work on XYY, me and a fine
researcher in France.  I was first in studying a large number of men in
the general American population who were conspicuous for having the XYY
syndrome."

"How would you go about testing me, to see if I had it?"  President
Armitage asked.

"Same routine.  A photograph of even a tiny drop of any of your body
fluids and the telltale extra Y will leap out at you."  He pulled from
his jacket pocket a folded, rumpled sheet of paper, photocopied from a
medical textbook, and smiled ruefully: "I keep this with me to study at
odd moments."  When the men looked at the jumble of mixed chromosomes
from a man with XY structure, they saw forty-six chromosomes, not
arranged in the pair grouping under which they operated.  At the bottom
of the page, the twenty-two pairs had been drawn and arranged in
descending order from No.  1, the largest pair, to No.  22 for the
smallest, plus an unnumbered XY, indicating that this particular sample
came from a normal boy.

The complexity of these data was so awesome, and their implications so
profound, that editor Jimenez asked: "You have researchers

who can untangle this mess at the top?  Could you, for example,
arrange this man's chromosomes in their proper pairings?"

"I can do it almost automatically," and with the point of a pencil he
indicated in the midst of the jumble the big halves that were easy both
to identify and to pair up with their partners: "Surely you can spot
those big differences," and the men agreed.

"But when you work with this material, you memorize the chromosomes as
if they were your pets," and darting arbitrarily through the scattered
diagrams he rattled off their numbers.

"And the X and Y?"  Armitage asked, and without hesitating the
scientist identified the big X, explaining: "It's so big, makes you
think maybe the female component is much more important than the
male."

"And the tricky little Y?"

Pausing for a moment, as if reluctant to identify the chromosome that
had destroyed his reputation as a serious scientist, he at last pointed
to a nondescript minor figure bearing almost no identifying marks:
There the little bastard is," but none of the men could spot it in the
top tangle.

"So what happens when a male baby has two of the little terrors?"

President Armitage asked, and with the tip of his pencil, Lewandowski
drew a second Y in the top diagram.

"The Frenchman and I proved at about the same time that young males
cursed with the XYY pattern were apt to have a handful of clearly
defined characteristics.  No question about it.  Bigger, heavier
musculature.  Abnormally aggressive.  Difficult to discipline.  And, in
their mature life, more apt to fall afoul of the law."

"These were discernible traits?"

"Absolutely identifiable.  Except that not every XYY adult showed
intractable behavior.  A man could be a hulking XYY and still be a good
citizen."

"What are you saying, Maxim?  Is he an ugly type or isn't he?"

"That's where I stumbled onto trouble," the scientist said.  The truth
seems to be that the XYY has a propensity toward bad behavior.  You
might say that he is eligible.  But that doesn't mean that he will be a
bad apple."

"So what happened?"

The Frenchman and I arranged for a brilliant experiment-study might be
the better word.  He would work through a large number of

French prisons.  I would do the same in America.  And we would
blood-type every man in those jails.  It was a huge task."

"What did you find?"

"In each country the prison population contained an abnormally high
proportion of XYY male inmates."

They did?"  Armitage asked.

"You mean that XYY men showed a propensity for criminal behavior?"

Lewandowski winced: "That's exactly what a newspaperman asked me.

"Does XYY pinpoint the criminal type?"  That's where the horror
started, with your simple question."

"How?"

"Well, as you might expect, I pointed out to the reporter every caution
an honest scientist would make: "Insufficient number of cases.

Many possible collateral explanations.  Possibly some overriding
causative factor.  Perhaps the fact that the XYY man was bigger and
huskier made the police more watchful.  Maybe the results were peculiar
to French and American jails."  I offered a dozen hedges against the
easy conclusion that the extra Y chromosome produced a criminal or a
potential criminal.  But he didn't listen."

"What did he do?"  Armitage asked.

"As he left me he asked one short question: "Dr.  Lewandowski, what's
in a chromosome?"  and I answered honestly: "It contains the genes that
control human development."  And the next day newspapers throughout
America and soon throughout the world screamed:

"American scientist discovers the gene that makes a man a criminal."

He stopped and laughed sardonically and said: "He didn't even get it
right.  We hadn't a clue which of the fifty thousand odd genes in that
fatal extra Y was guilty.  Only that it existed on Chromosome Y."  When
I challenged him about this he said airily: "Chromosomes are too
difficult for the general public to understand.  Genes are fashionable
this year."  So gene it had to be."

"Then what?"

The roof fell in.  A French newspaper pointed out that my colleague in
that country had done half the work and received none of the credit.  I
had stolen his material.  What was worse, my French friend said
accurately that he certainly had not come to the conclusion that there
was a specific gene or chromosome that determined criminal behavior,
and he cited all the caveats that I had given the reporter."

"Were you able to explain what had happened?"

"Not to this day.  Newspapers, magazines, television, full-length books
were so captivated by the possibility that an identifiable gene could
cause criminal behavior that in the popular mind I had made a titanic
discovery, and reputable biologists began to speculate on how we might
be able to go into the womb of a mother about to give birth to an XYY
boy and alter the gene structure so that the child would be born normal
and without a propensity for being a criminal."

"And?"  Armitage persisted.

"I became the laughingstock of the scientific community.  The mad
scientist from Vienna.  Restructuring the human race.  XYY baby boys in
special incubators at birth.  And any chance for the Nobel Prize went
down the drain."

This confession was greeted with a long silence, during which the
waitress informed the table that the yogurt machine was still on the
blink.  When substitute orders were placed, Senator Raborn asked: "So
what's the state of the inquiry into XYY now?"  and Lewandowski
explained: "Dozens, hundreds of careful investigations in prisons
throughout the world have confirmed that the jail population contains a
conspicuous plethora of XYY men."

"Doesn't that prove your original point?"

"Not at all.  For as I foresaw when I gave that damned interview that
condemned me, we still do not know what exactly it means.  Probably
ninety-five percent of XYYs lead quite satisfactory lives.  Why the
difference in the others?"

"What are you doing now, Maxim?"

"I'm a born scientist.  Science is all I ever did.  Once you've been
bitten by the bug you never quit.  I have a small laboratory
upstairs."

"What are you working on?"  Armitage asked, wondering if his college
might make some use of Maxim's investigations.

"The Human Genome Project."

"What's that?"

"Maybe the most ambitious project under way in the world today.

Comparable, I think, to a trip of humans to Mars."

"But what is it?"

"The scientists of the world have decided to draw up an atlas of the
human chromosomes, all forty-six."

"A big task?"  Jimenez asked.

"So big it stupefies.  The forty-six contain millions of genes. A
map has to be drawn of every chromosome, showing where and how its
strings of genes operate."

"To what purpose?"

Solemnly Lewandowski said: "To restructure the human race.  To rectify
God's mistakes."

Recognizing the gravity of what the scientist had said, and the depth
of his commitment to whatever role he was playing in this enormous
undertaking, they peppered him with questions, at the conclusion of
which he stated his creed: "When we have solved the secrets of the
genome, if we ever do, we'll be able to specify which genes in which
chromosomes produce which anomalies in human life and perhaps correct
them by adjusting the genes.  Don't laugh.  We already know which genes
in one chromosome are responsible for Tay-Sachs disease, which afflicts
Jews with a fatal disorder.  That already permits us to do genetic
counseling of young couples with the gene who may want to marry: "Since
you both carry a defective chromosome, better not have children."  And
we are certain that a defect in Chromosome ten produces the sickle-cell
anemia that plagues blacks.  If we correct the gene deficiency in ten
we protect the black man or woman from the disease, which is so
destructive."

On and on he went, identifying those errant chromosomes whose flawed
genes had been proved to be progenitors or at least warning signals of
this or that specific disease.  For example, a defective gene in
Chromosome 7 was suspected as an agent in cystic fibrosis and
Chromosome 13 was related to eye cancer.  The tertulia was astounded at
how much information had already been collected.  At the conclusion of
his summary he dropped a bombshell: "And through the most painstaking
work plus accidental good luck, we've learned that a gene in Chromosome
twenty-one is definitely related to the cause of Alzheimer's
disease."

His listeners leaned forward, for they had witnessed the ravages of
this mysterious disease, and they were mesmerized by what Maxim said
next: "Yes, we've found a large family in Sweden, many of whose members
contract what is known as early-onset Alzheimer's.  Very unusual, death
comes in the forties.  When we reconstructed the life history of each
member, some brilliant researcher, an Englishman, I believe, detected
that the troublemaker was Number fourteen."

The tertulia discussed this avidly as waitresses cleared the
nearby tables, and Lewandowski said: Taint clues, not nailed down yet,
also incriminate Chromosome nineteen.  I'm a member of the team,
scientists in various nations, who're working to map the genetic
structure and history of Number nineteen.  Maybe three hundred million
genes in that system, but with a mix of luck and insight we may be able
to spot the part of the chain that causes the trouble, maybe not."

"What do you actually do, Maxim?  Study a hundred thousand slides? Here
in our building?"

"No," he chuckled.

"Nothing so dramatic.  I receive reports from many sources.  One
researcher explores one segment of the gene chain, another works on a
different part.  And if we're lucky, a third, maybe in Bombay, works on
a fragment that overlaps the end of the first segment and the beginning
of the second.  He or she builds a bridge that I can report on to all
other workers on Number nineteen.  Parallel with our team, others are
working on Chromosome fourteen, and refining what's already been
accomplished on twenty-one."

In the silence that followed, Lewandowski took a long drink of iced tea
and said gravely: "In time we shall discover this dreadful secret, and
maybe we'll find some treatment that will enable us to help Mr.
Duggan's wife on the second floor and restore her to him."

No one spoke, for each member of the tertulia, deeply moved, had a lump
in his throat.  Finally St.  Pres spoke for the group: "Keep at it,
Maxim.  Lots of stricken people await your findings."

Most human beings, thanks to the benevolence of God, are spared the
more excruciating agonies of death, which cause the sufferer to scream
desperately for relief.  Berta Umlauf, a widow of seventy-nine who once
lived in the most attractive red-roofed house on Island 5 across the
channel from the Palms, had known death in its most horrible forms.

She had lived originally in Marquette, a town in the northern segment
of Michigan, the part that is separated from the more important
southern portion by the Straits of Mackinac.  As a pretty, petite girl
in

high school she fell in love with a six-foot-one football star
named Ludwig Umlauf, whose father, Otto, owned a profitable lumber
business and whose socially inclined mother, Ingrid, had great hopes
for her son, maybe winning a football scholarship to go to Notre Dame
or at least to Michigan.  Mrs.  Umlauf was distressed when Ludwig
informed his parents that he was not going to college; he would marry
his neighbor Berta Krause and start work immediately in his father's
lumber operations.  To escape interference from his mother, Ludwig
eloped with Berta and Mrs.  Umlauf angrily felt that the marriage had
damaged her son's promising future.

Ludwig did not think so, for with Berta's eager assistance and his
father's stern tutelage, he helped the Umlauf lumber concern to
thrive.

But as Berta watched her husband closely she had the suspicion that he
did not go away to college because he had been afraid to do so.  He
wanted to stay at home, in his familiar house and employed in the
business his grandfather had started and his father had extended.  With
old Otto and young Ludwig growing timber in their extensive woodlands
and selling it in a variety of outlets, the Umlaufs became more than
prosperous; they were rich.  When each year the ever increasing
earnings were made known to Mrs.  Umlauf, Ludwig hoped that she would
relax her hostility toward Berta.

But the wealthier the Umlaufs became, the more convinced Mrs.

Umlauf became that Berta had damaged her son's prospects: "A boy as
wonderful as him, who can make money so easy, he ought to be farther
along than he is.  You're holding him back, Berta, and it's a crying
shame."  Not even the birth of a grandson reconciled the contentious
old lady to her daughter-in-law, and the older Mrs.

Umlauf began to pressure her husband to leave the bitter winters of
northern Michigan and find a pleasant home in Florida, a plea he
obstinately rejected, sometimes with profanity: This is where we earned
our money, this is where we'll spend it.  Goddammit, this house will be
our home as long as I live," and he would remind his wife that he found
his only pleasure in life when hunting in the Umlauf game-rich woods or
sailing his boat on the waters of Lake Superior.  Like the stubborn
Lutheran he was, he refused to consider flight to an easier life in
Florida.

When blizzards howled through Marquette, piling snow on drive 2 1 8
ways, Otto and Ludwig reveled in the challenge and frequently told each
other in their wives' hearing: "Real men like this weather, Florida is
for sissies."

So as the men battled through the winters, amassing greater and greater
wealth from their lumber business, Grandmother Umlauf grew increasing
embittered, and while the men were absent much of the time either in
the woodlands they controlled or in Detroit and Chicago selling their
lumber, the two women stayed close to their tension-filled house,
living together in a kind of hateful truce.  It was ironic that old
Mrs.  Umlauf should have despised her daughter-in-law, because Berta
too wanted to leave the bitter winters of Marquette and find refuge in
Florida or Arizona, but regardless of how often she told Mrs.  Umlauf
about this the older woman could not believe that they were allies.

Berta often wondered why, with Ludwig's wealth, she could not have a
home of her own, but he squelched any such suggestions by citing two
good reasons: "Umlaufs have always stayed together.  That's where we
get our strength.  And besides, Father controls all the money.  I don't
think he'd let me have a house of my own.  He always lived with his
parents.  Didn't get ownership of this house till my grandfather
died."

If Berta reopened the question he would snap: "It would be sinful to
waste money on two houses when one of them is all we need."  He seemed
unaware that few families in the region were so rich at the bank or so
impoverished at home.

Berta believed that Ludwig's fear of moving to a new home was a
continuation of his fear about going away to college and his fear of
striking out on his own to escape the tyranny of his father: My husband
is a big man, just as he was a big football player when I adored him in
high school, but he's hollow-he really has no backbone.

Yet despite the tensions that poisoned this hate-filled house, on
Sundays the Umlauf family presented a portrait of unity as they marched
together to the nearby Lutheran church: short, round Otto and tall,
acidulous Ingrid in front, bulky Ludwig towering behind, with lively
little Berta and their son beside him.  They were referred to
collectively in the community as the Umlaufs and to imagine one
separated from the others would have been impossible, but when they
returned home, each adult went his or her own way.

In this world of bitterness, Berta found solace in her son, Noel, a
tall, handsome boy like his father.  Endowed with a benign attitude
toward

life, he liked school, did well in his classes and had a host of
friends with varied backgrounds.  He never behaved with the arrogance
characteristic of many sons of millionaires and he was a lad of whom
any mother could be proud.  Berta reveled in his companionship.

In the warm summers spent on the shores of Lake Superior Berta had a
marvelous time with her son and his friends, but when January came to
lock the four older Umlaufs indoors while Noel was away at boarding
school, life again became hateful.

One wintry day she had her first taste of what death was going to be
like among the battling Umlaufs.  She was not afraid of the
phenomenon;

the deaths of her own parents had been a calm passage from existence to
nonexistence, and she was proud of the courageous manner in which they
had said farewell.  She had suffered pain in losing them but not
wrenching anguish.  On this day, when she was alone in the house with
Mrs.  Umlauf, the old lady said: "Today we settle it.  I'm going to
Florida, and if he doesn't like it he can go to hell."  Since she had
never before spoken like this, Berta realized that a change of some
magnitude had occurred, so she was not surprised when Mrs.  Umlauf tore
into her husband the moment he arrived home for lunch: "Otto, I'm going
to Florida."

"Not with me.  Florida is for sissies."

Then I'm a sissy and I'm going."

"What are you going to use for money?"  In the furious discussion that
followed, Berta heard confirmation that Old Man Umlauf controlled not
only his wife's money but also most of his son's.  He had promised them
that he would be generous at death, but until then he would remain in
charge.  Mrs.  Umlauf stormed at his unfeeling dismissal of her wishes,
and when her rage achieved nothing she tried tears, and these he
dismissed with contempt.

When he returned to his office, she watched him go, accompanied by his
subservient son, then told Berta in a harsh, rasping voice: "If he
wants to control everything till he dies, I hope he drops dead before
nightfall."

This was such a horrid statement that Berta had to remonstrate:

"Mrs.  Umlauf!  Don't say a thing like that.  You'll bring a curse on
this family."

"Shut up.  Our bad luck started the day you came into this house."

Berta wanted to point out that she had tried many times to leave and
had not been allowed, but she realized that such a comment would
accomplish nothing.  Sitting silently in the cold, dark living room,
she stared out the window at the stormy lake, feeling frail and
overpowered by her mother-in-law.  She remained in low spirits for some
weeks, contemplating the dismal present and an even bleaker future.

She was forced to rouse herself from her lassitude when Old Man Umlauf
fell ill as if in obedience to his wife's curse.  He was put in a
downstairs room, which was converted into a kind of family hospital,
and there he lay for three weeks, growing steadily weaker in body but
more violent in spirit.  He spoke abusively to his two doctors, made it
clear that he despised his wife, voiced suspicions about his son's
ability to continue the business, and ordered Berta around as if she
were his slave.  Expecting no consideration from his wife, he turned to
Berta for his needs.  One night after supper she suggested to Ludwig:
"We could get nurses, maybe," but he gave a stolid German answer: "We
take care of our own," and to his credit he did, watching over his
father through the night and helping Berta with her arduous duties
during the day.

She was in charge late one afternoon when the older Mrs.  Umlauf came
into the front room, studied her husband's inert form and asked almost
hopefully: "He isn't dead, is he?"  When Berta said "No' she seemed
almost to accuse her daughter-in-law of intervening to prevent his
death.  There were ugly scenes with her son, too, until the entire
house seemed to be contaminated by what should have been the simple and
natural act of dying.  When it became apparent that death was
approaching, Berta begged her husband and mother-in-law for permission
to move him to the hospital, but Ludwig said something she would hear
frequently in the years ahead: "We take care of our family.  What would
the people in this town say if we shunted him off and let him die in a
strange place?"

Three days later Otto did die, at home, vilifying his wife, his son and
his thoughtless daughter-in-law.  It was a death as tormented and ugly,
Berta thought, as her parents' had been serene and almost lovely.  And
at the burial, on a stormy day when the minister hurried through the
ceremony to the relief of all, she did not join the group prayers, for
she was intoning aloud, but softly enough so that those nearby could
not hear: "I shall not die like this.  It is lacking in grace, and God
could not have meant His children to go this way."

One week after the funeral, Mrs.  Umlauf, having been assured by

the family lawyers that the entire lumber estate was left not in son
Ludwig's control but in hers, turned its management over to her
accountants and boarded a train for the west coast of Florida.  She
went directly to the office of a real estate agent, who cried: "Coming
south from those horrible winters in northern Michigan, you've landed
in paradise, Mrs.  Umlauf.  Is that name Swedish, perhaps?"

She hated that question.  Swedes were people in Minnesota that others
made jokes about.

"The name is pure German.  From the heartland of that country."

"I can see you're the kind of woman who knows what she wants.  I'm
going to drive you over to that chain of little islands across the
waterway we call the channel, and there you'll find some of the best
building sites in Florida, west coast or east."  When he reached Island
5 he took her to the inland waterfront and showed her how a house built
on this site would enjoy the best possible orientation: "Away from the
high winds that sometimes blow in from the gulf, you have your own
lovely waterway in your lap, and across the channel that wonderful open
land.  But at the far end they've built a state-of-the-art retirement
area, the Palms.

Look into it, you being so close at hand-if you take this place, that
is, and build your dream home here.  I represent the people operating
the Palms, if you're ever interested."

Brusquely she dismissed the idea, refusing to accept his card: "I would
never set foot inside a retirement home-full of lonely widows and
paupers abandoned by their families."

"You are so right!"  the agent enthused.

"You should have your own home.  Sit on your patio in the evening and
watch the dolphins and the sailboats go by."  When he saw that she was
interested in the land he assured her: The day you buy this heavenly
spot, my brother-in-law can start building your dream house ten feet in
from that glorious water."

Two days later she bought the land, and in next to no time had the
agent's brother-in-law building her dream house.  The moment it was
finished, with electricity and water connected, she moved in with just
a bed, a few chairs and kitchen equipment: "I'll furnish as I go
along.

That way I'll be sure I won't buy anything I don't really need."

The house, a spacious one-story tropical affair with a red-tiled back
porch facing the waterway had three bedrooms plus another roomy one
with its own kitchen, dining room and a private entrance that made it a
separate apartment for her son, Ludwig, and his wife, Berta, who
wondered why, if Mrs.  Umlauf disliked her so vehemently, she insisted
on having the younger Umlaufs sharing her house again.  Berta
eventually came up with two explanations: she was afraid of living
alone, and the old man's will dictated that Ludwig would not inherit
the family business until his mother's death-to Berta an indication
that, like her, the old man had been suspicious of his son's ability.

There was a third reason, which Mrs.  Umlauf often recited to Ludwig
and Berta: "It's your duty to look after your mother.  What would the
people in Marquette say if they heard you'd abandoned me?"

"But if I stay down here," Ludwig asked almost petulantly, 'who'll take
care of the lumber in Michigan?"  and his mother informed him:

"I'll be in charge-through our accountants in Marquette," and when
Berta heard these dismissive words she knew that whereas she too had
wanted to come to Florida, she was now a prisoner here, just as she had
been in Michigan.  Nor was there any change in her personal hell, for
her mother-in-law reminded Berta and anyone else who would listen that
it was she, Mrs.  Umlauf, who provided everything.  She dominated Berta
and used her like a slave.  Why didn't Ludwig object to such debasement
of his wife?  He had never stood up for his own rights against his
domineering father and so lacked the experience and fortitude to
challenge his mother.

The Umlauf place, as it was called, was recognized as one of the finest
houses on the chain of man-made islands, for it was well designed,
sturdily built, handsomely landscaped and eventually properly
furnished.  Its screened-in porch provided a grand view of the waterway
and the wild savanna on the opposite shore, but what went on inside the
house was not pleasant, for as Mrs.  Umlauf aged she became
increasingly dictatorial.  When Berta invited her son's family-Noel,
his wife, Gretchen, and their bright son, Victor-to visit, the
cantankerous old woman complained so bitterly about the little noise
they made, and was so harsh in reprimanding them, that Noel and
Gretchen begged Berta for permission to leave before their planned
visit was over, and one time Noel actually said: "Mother, when I leave
this polluted place I might never return."

"Oh, Noel!  Don't surrender the beauty of this place because an
evil-minded old woman has spoiled it for you," but he said: "Watching
her in action is too painful."

Berta was the first to notice that Mrs.  Umlauf's health was
deteriorating, but when she pointed this out to her husband, he
dismissed the idea: "She's cranky.  Always has been, but it's our duty
to pamper her," and indeed it was, for she still controlled the family
fortune.

However, her decline accelerated so noticeably that Berta herself
called the local medic, Dr.  Farquhar, who said as soon as he saw the
old lady and took a few tests: "She's in far worse condition than she
realizes or you guessed.  She ought to go immediately into some center
that can give her twenty-four-hour care.  If you know of no such
places, I can steer you to one."

When Ludwig was informed of the diagnosis he said firmly: "My mother
will never be stuck away in a nursing home.  What would people say of a
son who allowed that?"  and it was on the basis of this oft-repeated
statement that the Umlauf couple arranged the patterns that would
dominate their lives in Florida.  Old Mrs.  Umlauf, fading rapidly,
required almost constant attention, for her mind wandered;

she was not always sure where she was; she could not begin to feed
herself, and she became incontinent.

She seemed to take perverse pleasure in being incontinent at the most
outrageous times and places.  Her son, who was appalled at such
accidents, found it impossible to cope with them and the task fell to
Berta.  One day when four accidents occurred, necessitating repeated
cleanups, Berta said in tears: "Ludwig, we can't go on like this. We've
got to find a better solution."  but he adamantly refused to allow her
to look for a nursing home or to employ outside help: "It's our duty to
look after her.  No mother of mine will ever go into a nursing home.

Our friends in Marquette would be horrified."

In despair, Berta slipped out one day to visit with Dr.  Farquhar in
his office: "I'm in danger of losing my mind.  What can I do?"

"Berta, many families face difficult problems like this.  Your case
isn't special."

"What do the others do?"

"If they have money, they find a responsible nursing home.  If they
can't afford that, and many can't, they cope."

"How?"

"The way you are."

"And if I say I can't?"

"At one point or another, they all do.  But in the end they cope."

"Am I close to a nervous breakdown?"

"You may be.  I've been watching you!"

"Would you tell my husband?  He seems not to be aware."

"Husbands frequently aren't."  When it appeared that Farquhar too was
turning a deaf ear to her predicament, Berta lost control.  Bowing her
head and weeping pitifully, she whimpered: "If I can find no help from
anyone, what can I do?"  The sight of this doughty little woman so
overcome by her terrible problems made the doctor realize that he must
intrude in family affairs more deeply than he wished.

"I'll try to make your husband understand."

At first Ludwig refused to listen: "Looking after Mother is the
Christian thing to do."  This rote repetition infuriated Farquhar, who
snapped:

"Don't be ridiculous.  Your family is in such pitiful shape that your
Christian duty is to straighten it out."  When Ludwig shook his head
negatively, Farquhar said in a more persuasive voice: "Ludwig, can't I
make you see that if you don't get help for Berta right away, you're
going to have two terribly sick women on your hands?  Then what are you
going to do?"

The doctor delivered this judgment with such grim force that Umlauf had
to listen: "What do you think I should do?"

"Get a nurse to help through the night.  And two days a week, you watch
your mother so that Berta can be free to do whatever she wants to
do."

"She wouldn't want to be away from Mother, knowing that she might need
her."  He spoke so confidently on Berta's behalf that Dr.

Farquhar laughed: "Husbands often fail to see that their wives are
having deep trouble.  Mr.  Umlauf, let me send you an excellent
practical nurse I often use.  She'll make this place a home again," and
grudgingly Ludwig agreed, although he feared that the expense would be
tremendous.

The nurse was a rather large black woman, who arrived in a very small
car which she parked with considerable skill.  Her name was Lucy
Canfield and she did exactly what Dr.  Farquhar had predicted; she
brought comfort and ease to the Umlauf home.  Appearing each afternoon
at five, she prepared a light supper for herself and the family, then
bathed Mrs.  Umlauf and prepared her for bed.  When the old woman
raised a rumpus during the night, as she loved to do, Lucy was there to
absorb the abuse, allowing the younger Mrs.  Umlauf to sleep.

But week by week the patient declined until at last she lay
immobile in bed, a harridan who screamed at everyone, demanded constant
attention day and night, and approached her certain death without a
shred of dignity.  When Berta recalled her own mother's behavior in her
last moments, she wept at the contrast.  Her mother had said quietly
one afternoon: Today I would like to see the sunset," and Berta had
replied: "It's a mite cold out there, Momma," but the sun was so
brilliant as it dipped toward the west that she complied with her
mother's wish.  Bundling her against the wind, she wheeled her onto the
porch from which she could see both the dying sun and Lake Superior,
and there the old lady sat, hands folded, to view for the last time a
scene she loved.  When Berta came to fetch her, she was dead.

For three agonizing days Mrs.  Umlauf wrestled with her bedclothes,
soiled her sheets, screamed at Lucy for her clumsiness, at her son for
his indifference and at Berta for ruining her son's life.  On the
fourth day she died, and although no one said: "It was a mercy," the
three who had taken care of her believed it was.  At the funeral, which
was sparsely attended, Berta renewed her earlier vow: "I will not die
like this.  There must be a better way."

Life became easier with the passing of Mrs.  Umlauf, and Berta was
allowed to bring down her son, who had been looking after the Umlauf
lumbering empire, and his high-spirited wife and son to spend long
vacations in the near-empty house.  But Ludwig's behavior began to
change, and Berta saw clearly that her husband was beginning to
recapitulate the steady decline of his mother.  He became forgetful of
even the simplest details.  He was increasingly irritable.  He lost
interest in things and would sit for long periods out on the enclosed
porch staring at the waterway but finding no pleasure in it.  What
really surprised Berta was that he turned over the financial management
of his mother's estate to the accountants in Marquette, so that Berta
lived in a kind of shapeless world, which distressed her.

Two aspects of his behavior caused her serious apprehension.  He loved
to drive but became increasingly unable to do so and refused to turn in
his driver's license.  When Berta suggested he do so, he shouted at her
that he could still drive as well as ever.  This first problem was
solved by Dr.  Farquhar, who refused to certify his eligibility for a
renewal, and because the situation was acute, he arranged for a
policeman to come to the house and ask for the canceled license.

With a concession that surprised everyone, Ludwig turned over the
precious document and allowed Berta to drive him, even thanking her
when she did.

The other problem was never solved.  From time to time Berta would
enter a room to speak with him only to find that he had vanished,
disappeared without any warning that he was going to be out taking a
walk.  Frightened at what might have happened to him, she would run
about the neighborhood, over the bridges that joined the islands, and
find him often a far distance from home, striding along happily,
unaware of where he was or by what route he might be able to return
home.  But he was always glad to see his wife and did allow her to lead
him back.

After the fourth or fifth such episode she consulted Dr.  Farquhar, who
listened, then said: "Berta, the doctors at the top of our profession
have recently defined what appears to be an old disease with a new
name.  We've always had cases like your mother-in-law's and Ludwig's,
senility we called it.  But now they've identified a special type of
senility, Alzheimer's disease, named for the doctor who described it.
He was a German at the beginning of the century-it's taken all that
time for his discovery to be accepted.  I think Ludwig has
Alzheimer's.

The basic thing you must understand is that it's like no other disease
we know.  A doctor cannot say for sure that a patient has it.  No
measurable or testable symptoms, no specific cause."

"Then how do you know?"

"When the patient dies, an autopsy of the brain shows that radical
changes had taken place.  The brain cells had died.  A large proportion
of the connections that control memory, reasoning, the ability to
recognize old friends or family members, they'd been destroyed.  And
that visual inspection of the dead brain during an autopsy is the only
sure proof."

"Then how can you say that Ludwig might have this disease?"

"Sounds silly but what I'm about to say is true.  We investigate and
dismiss one possibility after another.  Ordinary brain damage?  Not
that.  Malfunctioning of the carotid arteries that carry blood and
oxygen to the brain?  Not that.  Standard decline into senility with
weakening of the entire body?  Not that.  When we've thrown out all the
logical possibilities, what we have left has to be Alzheimer's."

"Will you please start the testing on Ludwig?  I want him given every
chance of a decent life."

"We've already done most of the tests-that is, you have."

"Me?"

"Yes, you're surprisingly well informed on these matters.  Comes from
what you've told me about the deaths of your in-laws.  You tell me that
Ludwig cannot remember what happened a few days ago but he rambles on
about events that happened decades ago.  You say that sometimes he
looks at you and cannot remember who you are.  And most important, that
he seems to be in good health because he takes long walks but never
knows where he winds up or how to get back.

Classic descriptions, Berta."

"And what other tests?"

"Blood tests, but I've already done them.  And that leaves the two new
ones.  A check of the carotid arteries that run up the neck-that's the
easy one.  And the very new CAT scan, a remarkable instrument that can
see through bone and into the brain.  Will you inform your husband
about the necessity-' "Ludwig's afraid of everything.  And he's never
listened to me.  You tell him, he trusts you."

The carotid test, which involved ultra sensitive tracking of the
behavior of the great neck arteries, created no problems for Ludwig,
but the CAT scan was another matter, for it not only came on a bad day
when his mind was severely unfocused, but it also involved his being
stretched out flat on his back, his hands strapped to his sides because
he was fractious, and his head and torso being moved slowly into a dark
tunnel whose curved top came down a few inches from his face.  For an
ordinary patient it would have been frightening; for Ludwig it was
terrifying, and despite his hands being immobilized, his strength
enabled him to throw himself off the movable stretcher on which he had
been placed.

The three nurses who operated the device plus the able doctor in charge
were powerless to get him back on the stretcher that would carry him
into the machine, but as he struggled, Berta whispered into his ear as
the nurses held his head: "Your mother wanted this done, Ludwig.  She
said it was no big thing."

"Did she have it too?"

"She did."  Comforted by that mendacious reassurance and a momentary
return of normal thought, he said suddenly: "You can take off these
things," and when the straps binding his hands were removed, he climbed
onto the stretcher and lay back like a satisfied child as he was slowly
moved into the dark cave of the machine.

As Dr.  Farquhar had supposed, all tests were negative, so that he
could tell Berta with some reassurance: "We've excluded everything.

What's left has to be Alzheimer's."

"But we'll never be sure until he's dead and you can look directly into
his brain?"

That's right," and he gave her two books dealing with this dreadful
disease, plus the fearful summary: There's no cure.  There is no
remission.  Soon he will not even know who you are.  But as his brain
dies, his body will seem to grow stronger.  You must have heavy locks
on the doors or he will wander off and you might not be able to find
him."

"Would having Lucy Canfield in to help give me the assistance I'll
need?"

"You'll need two Lucys, one night, one day.  Can you afford that?"

"Yes."

"But the more sensible solution, and I've watched this in several
cases, would be to find a good nursing home, and they do exist, you
know, and-' "No!"  Then, because her dismissal had been so
instantaneous and fierce, she explained: "After the rather painful
deaths of his father and mother, Ludwig took down our family Bible,
made me place my right hand on it and swear that I would allow him to
die in our home and that I would never under any circumstances put him
in a nursing home."

"He could not foresee the circumstances."

"But I took an oath.  More important, when I promised I saw the
terrible fear in his eyes.  I have to live with that."

Lucy Canfield had a black friend almost as reliable as she, and the two
helped Berta maintain a comfortable home for this giant of a man, a
former football player of some skill, who had to be watched twenty-four
hours a day.  His decline was swift, remorseless, terrifying and
repulsive.  When strangers saw her leading her husband by the hand,
they smiled, and children who became familiar with the sight sometimes
said cruel things: "Look at that little lady guiding that big,

dumb-looking hulk."  Ruefully she thought: He wasn't always a hulk.

In high school, he was everybody's idol.

As older residents on the island became aware of his illness, they
would telephone Berta when they saw him wandering and she would rush
out to rescue him, driving the tormenting children away and taking his
hand.  One such escape was more serious; Lucy had placed him on the
porch where he enjoyed watching the waterway, even though he could not
distinguish the boats or the lovely Washingtonia palms.  On this
occasion, when the urgent desire to go walking seized him he simply
strode through the screen, tearing it apart with his powerful hands,
and headed off in a new direction.

Because residents on the other islands were not acquainted with his
wanderings or the family to which he belonged, they ignored him, so he
walked happily across several of them until he reached the footbridge
leading to Island 11, which was slippery, and he fell into the water.
When the police found him hip-deep in soft mud, splashing his hands and
chuckling, they pulled him back to land, and recognizing him as 'that
walking fellow from Island 5," drove him home.  Berta, frantic on
seeing him wet and covered with mud, thought for a moment that he might
be dead.  Realizing how stupid that was, since he was walking toward
the house, she burst into laughter at herself.  The officers were
amazed that she should be laughing at such a moment, but were reassured
by her rushing to Ludwig and embracing him, mud and all.  She cried:
Thank God you found him.  Oh, thank you so much."  When the men saw the
screen Ludwig had torn apart they laconically remarked: "Better not put
him on the porch anymore."

More difficult to deal with was his failure to recognize the three
women who cared for him, or even to know that they were women.

Nor could he differentiate between the two black women and his white
wife, and when his faculties deterioriated so far that he became
abusive, he would curse them, convinced that they had stolen the funds
he kept in Marquette.

The inevitable decline to the point at which he could not attend to his
bodily functions resulted in one of the more distasteful routines for
the women.  Either Berta or one of his nurses would have to unzip his
trousers and encourage him to urinate properly, or lower his pants
completely and place him on the bathroom commode, followed by the
necessity of wiping his bottom.  Once, after such a performance, Lucy
brought the other nurse with her to face Berta: "We can't go on like
this.  It ain't human.  Over there is that building they call the
Palms, they have a fine hospital area, I work there sometimes.  You
could drive Mr.  Ludwig there in ten minutes, and they got ways of
handlin' a case like this.  I've seen it."

Without telling the women of her oath, Berta said stubbornly: "I cannot
take my husband to such a place-' "It's not a livin' hell," Lucy
exploded.

"It's better for him than here," and when Berta remained obdurate, the
women delivered the speech they had agreed on: "Mrs.  Umlauf, we can't
work here anymore."

"Oh my God!"  Berta cried.

"You can't leave me alone."

"Rachel, she has a cousin, a strong man, cares for people like this.

He has a man friend who helps at night.  We'll bring them to see you
tonight after they get off work.  You can trust them, but they cost
more money than you've been payin' us."

"If it's money you want-' "We want out.  We'll bring the men
tonight."

When Berta saw them she realized how shattered her world had become,
for the two men were rough types she would never have allowed near her
house under ordinary circumstances.  Now she must invite them in and
live with them, the cousin during the day, the stranger at night.  But
she saw that they were big enough to manage Ludwig, and she gave thanks
for that.

The two men moved into the house, and they brought stern discipline to
Ludwig.  He would do as they said, and if he tried to go his stubborn
way, they were capable of knocking him about until he behaved.  They
were not tender-loving-care nurses but they were effective.  However,
after they had dealt with Ludwig for two weeks, they, like their cousin
and Lucy, wanted to speak with Berta: "Miz Berta, him and me works part
time at the Palms over there.  You never saw a better place.  Clean.
People who knows what they're doin'.

Real professional.  They can do the job much better than us, and you
got to see it."  Timothy, the bigger of the two men, insisted that
Berta drive over to the Palms right then, and when he led her to the
second floor where he had worked with Alzheimer's patients, everyone
knew him and said a warm hello.

Under his guidance, and with assistance from Ken Krenek, Berta had as
favorable an introduction to Assisted Living as possible, and

when Krenek learned where she lived and what her problem was, he said
enthusiastically: "Mrs.  Umlauf, it's simple.  You let us care for your
husband, we're good at that.  And you remain in your home and drive
over here as often as you wish-even take your meals here, that could be
arranged."  Then he added: "It's the orderly way to handle it," but at
that moment she was powerless to accept: "I shall remember what you
said, Mr.  Krenek.  It makes great sense."  As she left Assisted
Living, she stopped at the exit, turned wistfully to look at the
attractive complex of buildings and burst into tears to think that she
must forgo such an eminently suitable place.

Ludwig's death did not come quickly.  The black men labored with him
for half a year, wondering between them when the old man would have the
decency to die.  The accountants in Marquette wanted to know whether
Berta was really paying out such huge sums for house care when public
services must surely be available.  They even flew one of their team
down to see whether the widow Umlauf, as she was referred to on their
books, was being bilked by Florida sharpies.  At the end of one day's
inspection the man said: "Mrs.  Umlauf, this arrangement is ridiculous.
I was at that fine place just across the bridge and their staff can
take the matter off your hands for less than you're paying now. Please,
in the name of common sense, consider such a solution."

When Berta heard these words pronounced with an accent that made her
think she was back in Marquette, the bitterness with which she
remembered that unkindly place overcame her: "What would the people in
Marquette say if they learned that I had placed my husband in a nursing
home?"  and the man said: "Yes, that would be a consideration.

But I believe we could arrange it so they'd never know.  He'd still get
his mail at this address."

Ludwig Umlauf finally died because his tangled brain could no longer
send protective messages to the vital parts of his body.  Brain, lungs,
kidneys, respiratory system all seemed to collapse at the same time and
he died not knowing where he was or who was tending him.

He could not even differentiate his wife from the big black men who
took care of him.  Even his legacy of more than six million dollars
presented problems, for he had never bothered to write a will.

On the day after his estate was finally settled, Berta met with her
son, his wife and their son in the library of her home on Island 5: "My
beloved children, these years have not been easy.  I wish you could
have lived here with us as I had intended.  But in these harsh times
I've learned several lessons that will determine the rest of my life
and influence yours when I'm gone."  At this point her son moved his
chair closer to hers and tenderly touched her arm.

Noel had acquired his un-German name in a curious way.  His
grandfather, gruff old Otto Umlauf, had insisted that when a grandson
came along, he must be named Otto, to preserve the family tradition,
and he was so christened.  But the registry book also showed something
the older Umlaufs never discovered: Berta, acting on her own, had
slipped in a middle name that she had always intended for a son, if she
had one, so the young man now sitting beside her carried the legal name
Otto Noel Umlauf.  On the day he went off to school he took with him a
note to hand the teacher: "My name is Noel Umlauf," and so he became a
tiny testament to the romanticism and independence of spirit that Berta
Krause had nurtured as a girl.

She said: "As you know, I have been deeply and tragically involved with
three deaths in this family.  Your grandfather Otto, your grandmother
Ingrid, and your father, Ludwig.  I better than anyone living can tell
you that each of them approached death with no inner courage to make it
a natural part of life, and no concern for those they would leave
behind.  I can only say that they died miserably and in ways that
terrified both them and me.

"Well, I do not intend to die the way they did, and I want each of you
to remember what I'm about to say.  And for the love of God, keep in a
safe place the documents I'm going to give you.  Listen carefully.

"As I grow older and fall into the decline that overtakes all of us, do
not, I pray, do not take me into your homes to be a burden, an expense
and a shadow over your normal lives.  You, Noel, do not allow false
family pride to keep your wife from putting me in a nursing center of
good reputation where I can die in peace and with dignity.  You,
Victor, never say: "Isn't it awful that Grandmother has to be in a
nursing home when she could have remained in her own home?"  To all of
you, do not give a damn about what the neighbors in Marquette or
anywhere else say about how you handle this problem.  Think only of
your own welfare and mine and do the right thing, the Christian thing,
and help me to die properly."

Everyone began talking animatedly, but no one in the room was uncertain
as to what Berta had said with such dignity and force.  She resumed
speaking: "I have prepared, with the assistance of an excellent book,
what lawyers now call a living will.  I need two witnesses who can
attest to my soundness of mind to sign it.  Noel and Victor, would you
please come here?"  From her desk drawer she removed two copies of her
will and a pen.

"As you can read for yourself, it says that when I reach the point at
which I am brain-dead, I do not want to be kept alive as a vegetable by
the latest miracles of medicine.  I want to be allowed to die simply
and honorably.  And the will states specifically: "I do not want
cardiac resuscitation, mechanical respiration, tube feeding or
antibiotics to keep me alive physically when I am already dead mentally
and spiritually."

She looked intently into the faces of her son and grandson.

"These are my wishes and I can tell you that I'm thinking more clearly
at this moment than I ever have in my life.  Please sign."

Respecting Berta's deep feelings on the subject, both Noel and Victor
signed the will on the lines provided for witnesses.  Then Berta handed
Noel one copy of her will.

"I give you this paper as a sacred trust.  Please be guided by it."

Berta continued: "I have made my estate will and filed it, but all you
need to know about it is that whatever funds I have when I die will go
to you to enjoy in your lifetimes.  I leave no trusts or clever
documents to try to retain control over my money.  It will be yours at
the proper time and you are not to beg me for your share before I die.
I won't give you any.  But with this next paper I do give you this
wonderful house.  I'm giving it to the family as a unit.  As of this
afternoon.  If you look you'll see it's dated so that you take charge
tomorrow, and I hope you enjoy it as much as I did in the days when
life here was good."

This, of course, caused immense discussion, and she let it run without
further comment.  As it died down she said: "I want all of you up at
seven tomorrow for an early breakfast, because at eight-thirty a truck
will arrive and I'll need help from all of you.  Your problem is this:
"What should Grandmother Umlauf take with her when she moves from this
big house into a little apartment in that big building on the other
side of the channel, the one you see from our porch?"

Because that's where I'm going to live for the remainder of my life."

There was an outcry at this, with her daughter-in-law saying repeatedly
that she did not want their mother to live in a nursing home, but when
it became obvious that Berta was determined to do exactly what she
said, talk centered on what she should take from the large house to
what was probably a minute bed-sitting room with a bathroom and maybe a
small kitchenette.  Berta disabused them of that perception: "It has a
large bath, a full kitchen, a large living room and two bedrooms.  So
I'll be able to use quite a few things from here."  Quickly she added:
"You understand, I've already bought two new beds, so that's not a
problem.  Everything that we leave here tomorrow morning belongs to
this house and to you."

By the time the young people went to bed, they had affixed to almost a
score of things little red tags that meant they were to go into the
truck, but after they were asleep Berta moved quietly about the rooms
removing two thirds of the markers.  She had always aspired to a neat
house devoid of clutter.

Next day by noon she was fully ensconced in her apartment on the fourth
floor of the Peninsula, and when her family saw the vistas framed by
almost every window-views of the waterways, the trees- as well as the
easy access to the elevators, they agreed that Grandmother Umlauf had
made a wise decision.

To celebrate the move, Berta had arranged with Dr.  Zorn for a table to
be reserved for a family lunch, to which they invited Andy.  As the
quiet luncheon started, for not many residents took that meal, he told
the Umlaufs: "We're happy to welcome a woman as distinguished as Mrs.
Umlauf."  Noel asked: "What's she done that we don't know about?"  and
Zorn replied: "You know about it more than anyone else.

Dr.  Farquhar told me confidentially what a heroic woman your mother
was in caring for three different members of her family who underwent
protracted deaths."

"She was a saint," Noel said, patting his mother's hand.  Zorn
continued: "We praise women for selflessly caring for others while
surrendering their personal happiness.  As you say, it's being a saint.
But now we have better solutions, and moving people like her to the
Palms is one of them.  Here we provide monitored care and loving
attention to the end.  Our center is able to do this because it has a
wonderful staff and caring residents like your mother."

The luncheon did not end on this lugubrious note, because Victor had
become fascinated at what was happening at a nearby table:

"Who's that interesting lady eating alone?"  and after a glance at
table fifteen Zorn explained: "We call her the Duchess.  She was a
woman of some social importance years ago, and she gets real pleasure
from pretending that she still is."

"You let her have a table all to herself?"

"At lunch we can allow it, to make her feel more important.  At dinner
we need every table."

"Does she eat with the others then?"

"No.  She has a snack in her room.  Alone.  But on the nights we show
movies she joins us after dinner, and we keep a comfortable seat
reserved for her when she comes, like a great lady going to the
opera."

Nurse Varney was the first member of the staff to recognize that Betsy
Cawthorn's amazing progress in mastering the use of her artificial legs
was only half the battle in her recovery.  Indeed, Nora saw real danger
signals.  The young woman was concentrating so completely, almost
fanatically, on strengthening the muscles of her torso and thighs and
managing her skeleton metal legs that she ran the risk of either
straining her system or driving herself with such compulsion that she
was bound to become discouraged and give up prematurely.  To protect
the girl's balance and long-range mending, it was obligatory that
someone lead her to new experiences and new concerns.  And that job
fell to Nora.

She started by picking up on the hint that Betsy had given during one
of the familiarization tours.  As they passed the corner where the
Bridge Fanatics congregated, the players had teased her about learning
their game and she had replied, half in jest, that she might do just
that.

Now Nora took her to the cardplayers and said: "This young woman needs
something to pass the hours.  She can't be sweating in rehab all day,"
and they took her in, arranging her wheelchair so that she could look
over the shoulder of one of the players who would whisper explanations
of what he or she was doing.  With the assistance of two books by
Charles Goren that Nora brought her from the library, Betsy learned the
game at a minimal level.

Most of the men and women made up teams at random, leaving the expert
players to themselves, and Betsy fell in with a group who played poorly
enough to find a place for her.  The two male members were Muley Duggan
and Harry Pidcock, a quiet, inoffensive Pennsylvania farmer.  She was
told by Nora that both men were married, but that their wives lived
separately from them on the second floor of the health-services
building-what this meant she did not at first understand.  The fourth
member was Marcia Raborn, wife of the senator who played with the
experts.  Betsy was delighted when she knew enough to make her first
finesse.  She had obtained the bid and was playing in hearts, and her
partner, Muley Duggan, had laid down the A-Q-8-7 of spades, so when she
led to his spades, hoping to catch the opponents's King, she intended
to play the Ace until Muley coughed so loudly that she knew she must be
about to make an error.  She studied the matter until it dawned on her
that it was much better to play the Queen, for if Mr.  Pidcock on her
left had the King, she would be sure of making two spade tricks.  It
worked so successfully that for the rest of the session she finessed
everything, learning that if she held 9-7 in her hand she could play
the 7 and isolate the 8 on her right.  Of course, she tried the device
when there was no reason to do so, but she had mastered one of the
fundamental plays of bridge, and from that solid start she could
progress to the other basics.  In less than two weeks she was playing
respectable beginner's bridge and was busy memorizing the Goren system
of bidding.

At about the time she learned about jump bids, she also learned more
about the mysterious responsibility that both Muley Duggan and Mr.

Pidcock had on the second floor of the health-services building.  One
evening after the bridge game ended, she asked Pidcock whether his wife
was improving in her recovery in Assisted Living, and he looked at her
with brimming eyes as he replied: "She's there permanently, I'm
afraid.

She has advanced Alzheimer's, and there seems to be no cure."

Such a statement astounded her, for she had only vaguely heard of the
disease, and when she started to probe for an explanation, Mr.

Pidcock excused himself and left.  Nor did Muley Duggan care to discuss
his wife's illness, but when the men were gone, the senator's wife
lingered by her wheelchair and said: "You were touching on delicate
matters, Betsy.  Those two men face one of the most terrible
afflictions we have here in the Palms."

"They don't look as if they had any illness."

They're fine.  It's their wives who have Alzheimer's."

"What is that?  I heard about it in Chattanooga but never took the time
to find out exactly what it is.  Please tell me about it."

Mrs.  Raborn proceeded to describe the disease in simple terms insofar
as she understood it and concluded: "So for reasons we don't
understand, the brain goes haywire, and there's nothing even the finest
doctors can do.  They're working like mad to solve this riddle, but up
to now they haven't got very far.

"So don't grow impatient with Muley and his gross jokes, or with Mr.
Pidcock and his fussy ways.  Those men are living saints, and you and I
should have such husbands-by the way, is there a husband lurking behind
the potted plants in your life?"

"No," Betsy said, but she blushed so revealingly that Mrs.  Raborn
thought: So Nora was right.  She's infatuated with the doctor.  And why
not.

"Well, when you get one, be sure he's as truly admirable as Muley and
Pidcock.  They tend to their wives faithfully, look after them week
after week, but neither of the women even recognizes them, neither
knows that this strange man coming to see her is her husband."  She
took out a handkerchief, wiped her eyes and broke into a soft chuckle:
"I sometimes tell the senator: "If that disease ever struck me, I doubt
you'd be as good a husband as Muley and Pidcock are," and he says, "I
suppose not."  I could bash him."

Betsy, moved by what she had heard, asked: "Would it be possible for me
to see these women?  I'm totally bewildered," and Mrs.  Raborn said:
"That would be easy.  You'd be startled, for they're as beautiful as
they were on their wedding days.  Mrs.  Umlauf, that little woman who
keeps so busy, she volunteers in Health and would be happy, I'm sure,
to show you what fine facilities they have over there.  You'll like
Berta Umlauf, a true Christian.  She survived what I'm told were two
Alzheimer's men in her family, although her father-in-law wasn't
diagnosed as such."  When Mrs.  Raborn dropped Betsy off at Nora's
office, she told the nurse: "I think this young explorer is ready to
tour Assisted and Extended, to see how we operate there.  I was
wondering if she could accompany Mrs.  Umlauf on her duties?"

"First-rate idea.  Thanks for the suggestion," and when Mrs.  Raborn
left her in Nora's office the nurse explained: "I'm in charge of those
two floors, but it would be better for you to see them through Berta
Umlauf's eyes, since she's a fellow resident."

"Mrs.  Raborn said Berta visits her floors every day and is
indispensable.  Is she paid for this?"

"Heavens, no!"

"You mean she volunteers?  Out of the goodness of her heart?"

"You got it right."  After getting two Cokes, Nora explained in detail
one of the miracles of almost any good retirement center: "We get women
here, cross section of the country, who have served their communities
all their lives.  For no pay.  They help run the hospitals, the
libraries, the church Sunday schools, the women's organization of the
American Legion.  They are God's right-hand servants, and without them
this would be a pitiful country."

She said that she had organized such women in the Palms into the Golden
Angels and provided each member with a bright yellow jacket:

"They wear them proudly as they move about Health, bringing loving care
and attention to the bedridden.

"From the moment Mrs.  Umlauf started to live here, she wanted to be a
Golden Angel.  If I'd rejected her I think she might have shot me.

These days if she has to be absent from her rounds, she comes and
apologizes to me.  God didn't make many like her, but when we get one
she does the work of seven.  When I turn you over to her, Betsy, you
are close to the heart of that wing up there."

Two days later, when Mrs.  Umlauf was asked if the girl in the
wheelchair could accompany her on her rounds she cried: "Oh, the people
would be pleased to meet someone as young and pretty and vibrant as
you, Miss Cawthorn.  They've heard you were here and how you got here,
that dreadful smashup."  Wheeling Betsy to a special elevator, she
said: "Miss Betsy, we'll start with the second floor, Assisted," and
within the first few moments there, Betsy understood the comfort that
Mrs.  Umlauf provided.  As they moved from room to room the feisty
little woman engaged in chatter or discussions of the day's news.  To
some she brought flowers, to others books, and even though she had been
in residence only briefly, everyone seemed to know her and responded to
her interest in their well-being.  Mrs.  Umlauf pointed out: "Everyone
on this floor, except for the Alzheimer's patients, is convinced that
she or he will be leaving very soon, either going back to their
apartment in Gateways or to their homes in the Tampa Bay area."

Betsy was wheeled into Marjorie Duggan's room, and for the first time
in her life young Betsy Cawthorn, child of affluence, saw an
Alzheimer's patient.  She was astounded at the cameo-like beauty of the
woman, who was in her late sixties but looked a serene thirty-five, her
silvery hair beautifully coiffed, and her trim figure enhanced by a
lace-trimmed morning gown.  Betsy was amazed at the elegance of her
face, its skin pale and almost translucent, like that of the women in
Pre-Raphaelite paintings.  She was, as she lay there in bed, beautiful
to look at, but she could not read books or comprehend a newspaper, or
look at television with understanding.  She did like music, but merely
responded viscerally to the beat-the structure and significance of the
melodies she could no longer grasp.

As Betsy remained transfixed by the sight of this cruelly wasted life,
Muley Duggan entered the room and almost shouted: "It's my bridge
partner!"  It was pitifully apparent that the bedridden woman did not
recognize her husband, as indeed she had not for many years.

Back in the hall, Mrs.  Umlauf assured Betsy that the cases of men with
the disease were just as harrowing, and as they sat at a table
overlooking the pond below, she told briefly of how her father-in-law,
Otto, and her husband, Ludwig, had died of Alzheimer's.

"Ludwig," she said, 'was a walker, and I tell you this because the huge
man whom we'll see next is a prodigious walker.  Let him have free
access to the elevator, he'd be downstairs in a flash and out the front
door.  We might not find him for two days, way down the countryside."

When they reached the man's room they found a big placid fellow staring
out the window at birds.  They stayed only a short while and outside
his door Mrs.  Umlauf said: The floor above isn't like this one at all.
Up there hope does not exist.  It can be cruel.  Do you still want to
try it?"

"Yes," Betsy said with no bravado.  The more I see, the better I'll
understand things," and back they went to the elevator.

The floor presented a striking incongruity: the decorations were
aggressively bright as if the occupants lived in a constant state of
euphoria, but the patients themselves were colorless and listless and
obviously awaiting death.  Betsy noticed the difference in how people
here greeted Mrs.  Umlauf, their tested friend, from how those below,

most of whom expected to be released from Extended Living, had greeted
her.

But volunteers like Mrs.  Umlauf did bring warmth and hope.  She talked
intelligently with the old people and let them know that she was just
about their age, but luckier in that her health was still pretty
good.

Also, these people could read, and watch television and enjoy music:

They especially like the afternoon talk shows when Oprah and Donahue
and Sally Jessy Raphael bring those unbelievable human beings on the
screen to discuss their woes or their weird lifestyles or their
defiance of accepted behavior; like the man who had been sleeping with
three sisters and saw nothing wrong in it, or the woman who was lending
her womb to her daughter who could not have a baby.  They spent some
time trying to figure that one out," Mrs.  Umlauf said.

"What was the official relationship of the mother to the baby or the
husband, whose sperm had been used, to his mother-in-law?"

To complete her rounds Mrs.  Umlauf looked into a room that terrified
her but that she felt obligated to cover.  Room 312 contained one of
the ugly aspects of the Palms, a very old woman stretched out on a bed
with a tall mechanical gantry reaching out over her.  From it was
suspended a network of electrical wires, plastic feeding tubes and
intravenous delivery systems sticking into her arms for the providing
of chemical food substances in liquid form.  The woman was obviously
brain-dead, and had been since before the day of Berta's first visit to
the floor, but through the brilliance of mechanical wizardry the
various functions of her body could be kept going, all except those of
her brain, which had ceased functioning nearly two years earlier.

Berta went through her routine: "Can you hear me, Mrs.  Carlson?

Mrs.  Carlson, do you want to be turned over to ease your bedsores?

Mrs.  Carlson, do you see my hand in front of your eyes?"

There was no response, nor would there ever be, barring the miracle of
Lazarus.  The harsh truth, however, was that many doctors in America,
most courts, and almost all legislators hoped for a recurrence of that
amazing incident when a man clearly dead rose and resumed his life.

And to keep that religious faith alive, about once a year in America, a
woman like Mrs.  Carlson, certifiably dead for two or five or ten
years, did miraculously revive and give renewed hope to those who
prayed for a repetition of such a phenomenon.  The caretakers on the
third floor kept hoping for such marvels.

Mrs.  Umlauf, who had prayed diligently for such divine deliverance in
the case of her three family members, had learned not to hope, but she
did voice one wish over which she did have some control: "Do not let me
or anyone I love wind up in some Room 312."

"Why do they allow this to go on?"  Betsy asked.

"The law.  We're not allowed, on this floor, ever to terminate a
lifesaving procedure without legal permission, and that's almost
impossible to get.  So the miracles of medicine keep life continuing,
but of course it isn't really life."  As she left the room she said:
"It's abhorrent, this place, and I cannot understand how it's allowed
to continue," and Betsy agreed.

As Berta was about to take Betsy back to Nora's office she was
intercepted by a very young nurse who said: "Mrs.  Pawling in 319 is
dying and wants you to help her make one last phone call, but they
won't let her.  Please come."

When Berta and Betsy entered the room they could see that Mrs.

Pawling had not long to live and they were appalled by what her problem
was: "I want to phone my lawyer in a little town near Indianapolis, but
they won't let me."

"Who won't?"

"Nurse Grimes.  All I'm allowed is local calls."

"I'll speak to Nurse Grimes," Mrs.  Umlauf said, but when she did, the
administrator for the floor said firmly and with an obvious show of
disgust: "That Pawling woman again!  Her children have given strict
orders, "No more long-distance calls."  ' "Can't I ask for an
exception?  I'm willing to pay for the call myself."

"No exceptions," Grimes said.

"If we did allow her to call, we'd have to pay for it.  Orders."

"Could I call downstairs?"

"Of course," and she shoved the intercom over to her.

When Mrs.  Umlauf got the central desk she said: "Delia, I want you to
allow Mrs.  Pawling, 319, to call Indiana.  Yes, I know it's forbidden,
but charge the call to me.  What?  You've never done it before.  Ask
Mr.

Krenek, he'll authorize it."  When she received permission she pushed
the intercom back to Nurse Grimes, who scowled so fiercely that Berta
thought, as she returned to Room 319: I wonder why she bothers to work
here?  She could certainly get a job in a munitions factory.

When she asked Mrs.  Pawling what she wanted to talk to her lawyer
about, the woman whispered: "The outcome of my son-in-law's appeal.

He's been in jail two years."  She sighed: "I begged Elinor not to
marry him, but he sweet-talked her."  When the call went through, the
old woman asked feebly: "Erik, what news?"  She listened, sighed again
and said: "You promised that this time .. ."  There was obviously a
long explanation, at the end of which she said: "I'm sure you did your
best, Erik, and if it wasn't my own daughter I'd say, "Let him rot in
jail," but she does want him out.  Just like the last time."  She told
him to keep trying, bade him good-night and asked Berta: "Did you pay
for that call?"  When Berta put up her two palms to show it was
nothing, the old woman said with grief in her voice: Thank you.  To me
it was important, but my son and his wife who are paying for this room
despise their brother-in-law, understandably."  She started to weep,
and when Berta tried to comfort her she whispered like a little
child:

"It's all ending so wrong.  It wasn't meant to end this way."

When Mrs.  Umlauf delivered Betsy to Nora's office, the nurse could see
that she had been deeply moved by what she had seen on floors two and
three, for she said in a subdued voice: "It was so eye-opening!

When you spend your time in the luxury quarters in Gateways and dine in
that handsome room, and you see the women with their Cadillacs, you get
the feeling that the Palms is reserved for millionaires and the
well-to-do.  But all the time upstairs, and perhaps nearer to God, are
these ordinary people who are struggling to stay alive.  It's really
sobering."

Nora was gratified to see Betsy's new maturity and her empathy for the
less fortunate residents.  She judged that now was the time to get down
to basics: "You're in the proper frame of mind, child.  And now you
have to plan ahead.  Three, four more months, you're going to have to
start looking around.  We'll have done all we can for you, and then it
will be up to you to build a new life for yourself.  I suppose your
daddy has enough to support you for a while?"

"My mother left me a trust fund, and on his own account he's not poor.
But he has two other daughters, you know."

"Why haven't they come down to see you?  It's not so far."

"They live in the North, Chicago and Omaha, and they were on hand right
away when I was in the hospital.  But yes, I can afford to look around
a bit when I get home."  She paused in a manner that suggested that her
plans did not involve returning to Chattanooga in a hurry:

"Nora, I've been deeply moved by watching you, the way you affect the
lives of so many people.  What's your secret?"  and the black woman
said: "I think you gots to love people.  I mean the good and the bad,
the living and the dying.  Just accept them, find out what's eating
them, and help them find an easier way.  I truly likes to help
peoples."

Betsy said: "You seem to speak in two tongues.  High school English
when you first meet the public, then old-style black lingo like we hear
in Tennessee when- What's your rule for using polite as against
down-home?"

That would be hard to say, Miss Betsy.  Maybe, the way you ask it, I
get back to down-home Alabama black earth when I'm talkin' about things
that matter, like you and the rest of your life.  Let's get back to
that.  You think you'll ever marry?"

"I've wondered about that a good deal since January and especially when
spring came.  April can be lovely in eastern Tennessee, and it occurred
to me one rainy day when it wasn't so nice that before the accident I
had five or six fine young men seriously interested in me, but after
the crash they seemed to evaporate."  She shook her head: "And those
that did come around wanted to be big brothers."  She studied Nora to
judge whether she should make her next statement, for it did sum up her
problem but not in a very ladylike way: "Boys in high school liked to
boast that they were divided into two groups, "Them as go for tits and
them as cotton strictly to legs."  What could I have to offer a young
man in the second category?"

Nora, who suspected correctly that what Betsy really wanted to know was
"What are my chances that Dr.  Zorn would ever be interested in someone
like me?"  knew that she ought to give an answer that would respond to
the deeper question, too.  Thoughtfully she said: "When you're a nurse,
like I've been, you stay around long enough, you see everything.  And
I've seen some of the craziest marriages God ever permitted.  There was
this dwarf girl in our town back in Alabama.  Sweet kid about three
feet six.  We all wondered: "What's gonna happen to Gracey?"  And what
happened to her was that she married a man nearly six feet tall, and
him a white, she a black.  But he'd been a missionary and was hipped on
Africa."  She continued with other remarkable mismatches in which women
who everyone had been sure would never land a husband had done rather
well for themselves:

"On the other hand, I could name just as many real beauties, you'd
think they had everything in their favor, they never married, or if
they did it would have been better if they didn't.  So Miss Betsy, I
ain't worryin' my head about you.  You got too much ridin' in your
favor."

She was pleased that Betsy liked to be with her and was eager to talk
about important topics; she knew it was therapeutic for her, an
important part of the Palms cure, but she was not naive about the
situation.  She was aware that Betsy came to see her so often in hopes
that she might also catch a glimpse of Dr.  Zorn and be seen by him.
That, Nora said to herself, is just the way it should be, but she was
vaguely perplexed as to why Betsy never spoke openly of her infatuation
with the doctor.

But now, at the conclusion of her illuminating tour of the other
floors, Betsy was eager to speak of those things that really mattered,
and she asked with amazing bluntness: "Nora, what happened in the
doctor's divorce?"

"It was a filthy business, I gather."

"Blame on both sides?"

"Mostly hers.  She resented the amount of time he spent on getting his
clinic organized.  She felt left behind socially, intellectually and I
suppose even sexually.  So she hooked up-temporarily-onenighters-with
younger men she met in bars and it all went bust."

"How do you know so much?"

"I have a nurse friend in Chicago.  I asked her."

"Betsy contemplated these answers for some moments, then asked:

"You think he'll ever marry again?"

"First four months he was here, all work and bustle, I said: "That
one's gun-shy," but since you came I'm beginning to think I was
wrong."

With disarming boldness Betsy asked: "Then you think I might have a
chance?"  and Nora replied: "I've been counting the days till you both
woke up.  Today, I'm glad to see, you're finally facing up to your
task."

"That's an odd thing to say-a task."

"Miss Betsy, you were damaged bodily, but it was physical and in the
hands of someone like Yancey you can be cured.  Andy has a much worse
damage, psychological, and only a person with extreme patience and love
can cure him."

"Is he as good a man as I think he is?"

"Better.  He does not make wrong or shabby moves.  He's quality, but
remember, he's gun-shy."

When Dr.  Zorn had first asked Miss Foxworth to show him the
confidential list of residents in Gateways whose rents had been lowered
so that they could continue living in the Palms even though their
investment income had dropped, he noted one name that was vaguely
familiar to him.  He learned from Miss Foxworth that Harry Ingram was a
seventy-two-year-old man who lived off by himself in one of the
smallest and least expensive units, and she characterized him as 'that
dear little mouse of a man."

Zorn, eager to understand all aspects of retiree management, felt it
his duty to seek out one of what someone had called 'our zeros' to see
if he could guess why management had extended financial aid to him.  So
he asked Krenek to arrange a dining table at which he could be alone
with Ingram, and when Harry arrived he found him to be quite
unprepossessing: a smallish man, less than five five and weighing about
a hundred and thirty-five pounds.  He had gone bald at the top of his
head but had trained the hair on the right side to spread sparsely over
the bald spot and to remain there when held down by copious amounts of
a heavy pomade.  He did not like to look people in the eye, but did not
stare down at the floor, as some did.  He let his somewhat watery eyes
wander from side to side, bringing them to rest at surprising times
when he looked someone straight in the eye to make some trivial
observation, which he delivered with a gravity more suited to the
Gettysburg Address.  When he did speak, it was with a slight British
accent: "My grandfather emigrated from Scotland in 1870.  He was thrown
out really, bad blood in the family, and he became a remittance man in
Nova Scotia, but he remained on the rolls of his home in Scotland, and
always thought of himself as a Scot.  When he had a son in Canada-my
father, that is-he registered him at the empire office as a British
citizen.  But later, when my father grew tired of the cold winters he
saved the money that still trickled in from home and moved to Illinois,
where the weather was better and where he met a farmer's daughter who
owned a bit of land in her own name.  Our name was really Ingraham, but
when he entered the United States an immigration official said: "Now,
that's silly.  If it's pronounced Ingram, that's the way we'll spell it
in God's country."  And Ingrams we became.  He never went back to
Scotland nor have any of us, but we celebrate Robbie Burns Day in
January and we have a few Victrola records of bagpipe music, dreadful
stuff."  It had been a long speech for him, so he felt no obligation to
converse the rest of the evening.

It had been a dull visit, so Zorn would have been surprised if, when he
left the table, someone had predicted: "Harry Ingram is about to
catapult the Palms into national and even international notoriety, and
in doing so, will account for a dramatic end-of-year rise in rentals,
converting your center into one of the top moneymakers in the Taggart
chain."

These unlikely events started one hot June day at four in the morning
with a telephone call from London, where it was already nine o'clock:
"Hello!  Am I speaking to the Palms?  Have you a tenant named Harry
Ingram?  Could you put me through to him?"

The night operator who had answered the phone pointed out: "Sir!

It's four o'clock in the morning here.  We don't like to call the
guests at this hour.  They become irritated."

"I assure you, Mr.  Ingram will want to bear the burden of my
interruption.  Please ring him."  And when a sleepy, not well-focused
Harry came to the phone, the man from London gave him startling news:
"Are you Harry Peter Denham Robert Ingram?  Good.  I have surprising
news for you.  The eleventh Ingraham baronet of Illsworth died
yesterday, as his younger brother did two weeks ago.  Since neither
brother left any heirs, the title passes to the collateral branch of
the great Chisholm family, and the heir of that line is you.  As of
this moment you are now Sir Harry Ingram, Baronet."  Pausing for some
moments to allow this astonishing information to register, the London
man explained: "In our system there are many, many men entitled to be
called Sir Thomas This or That, and when they die their title dies with
them.  But anyone with the title Sir Thomas Jones, Baronet, not only
has the title, but his heirs also inherit the title.  It's rather nice,
really, to be a baronet.  Am I correct in my records?  You have no
heirs, male or female?"

"Never been married," the bewildered baronet replied, at which his
informant said: "As I thought.  This means that when you die, barring
the birth of a child before then, which I suppose is unlikely ... you
are seventy-two?  Correct.  So at your death the title will pass to
another cadet line, the one in Australia.  Do you by chance happen to
know them?  Name of Stanhope?  No.  Well, that's how the matter stands,
and may I be the first to congratulate you, Sir Harry?"  and he hung
up.

At the same time that the official was informing Harry, his staff was
informing the London press corps that one of England's titles had now
passed into the safekeeping of an elderly resident in a Florida
retirement home, and news of this amazing development had been sent
from the London bureaus of the American news agencies to their offices
in the United States, where it was instantly circulated to newspapers
and radio and television stations.  Since the London release had
identified the nursing home as the Palms in Tampa, Florida, the
telephones in that establishment started ringing, and two television
stations soon dispatched camera crews to the scene.

By the time dawn broke, Nurse Varney was already commanding the
telephone system while Andy and Ken Krenek were directing traffic.
Ambassador St.  Pres had been alerted as someone who might understand
the niceties of the situation, and he was in Harry Ingram's little room
handling the phone there.  It was a tumultuous morning at the Palms as
word flashed through the halls that 'our Harry Ingram has inherited a
title in England."  It was generally supposed that he was to be at
least an earl, more likely a duke.

As the morning progressed Ambassador St.  Pres explained again and
again: "In the British hierarchy it's the next-to-lowest title that can
be given.  Below it is the simple honorific Sir Harry Ingram.  Next
above that is what he has, Sir Harry Ingram, Baronet.  Above that are
the viscounts and earls, and above those come the marquis and so on up
to the grandest of all, the dukes, Harry Ingram, duke of Sussex, or
whatever other majestic title his family might be entitled to."  And
that launched the epoch known at the Palms as 'the hunt for British
nobility."

Any book that gave the histories of the great families of English
history was grabbed at, as were back copies of magazines that had
portraits of the various British leaders, biographies of Princess Di
and Wallis Warfield Simpson, or anything else that even remotely
pertained to the elevation of ordinary Harry Ingram into the
aristocracy of Great Britain.  Ambassador St.  Pres struggled so
constantly to correct misperceptions that in frustration he suggested
that some night after dinner he would be glad to explain what their
respected friend Harry Ingram was getting into.

To his surprise, practically the entire population of Gateways, all
hundred and ninety-four, appeared, with latecomers having to bring
their own chairs.  His talk was a masterpiece of elucidation, delivered
in proper ambassadorial style.

The word nobility, in Great Britain at least, refers only to men and
women holding the top five ranks of honors in this descending order:

duke, marquis, earl, viscount and baron.  They are known as the
peerage.

Now you must understand that in the British Isles, the honorific Sir is
very widely used to bestow a knighthood on any citizen who performs
exceptionally well in public life.  A leading jockey can become a Sir.
A leading actor.  Famous cricket players.  Queen Elizabeth has awarded
the title in honorary form to Reagan and Bush.  And it's customary, if
a British foreign officer such as an ambassador has served well, to
award him the title in recognition."

"Would you be a Sir in England?"  a woman asked, and he said
truthfully: "I suppose my services in Africa might have warranted it.

But more important, I would think, is the fact that if the Palms were
in some British village, one or two of our residents might well be Sir
this or Sir that, and I'll leave it to you to speculate on whom I have
in mind."

This caused some buzzing, after which he said: "Now you understand that
if I were Sir Richard St.  Pres, then when I die, my title dies with
me.  My wife, if I had one, would not be legally entitled to be called
Lady St.  Pres, but her friends, out of courtesy, would continue to
call her so.  Then it would vanish.  Otherwise the landscape would be
cluttered with Knights and their Ladies."  He paused dramatically: "But
the title that our Sir Harry has inherited is a different kettle of
iish, because he can write after his name, Bart."  meaning baronet, and
in that case his title does pass to his heir.  But since Harry has no
heir, so far as we know, when he dies his baronetcy will pass to the
oldest male member of the next cadet line-' "What does that mean?"  a
man asked, and he said: "A subsidiary branch of the family, inherited
through some younger brother or close relative.  I believe Sir Harry
has already been informed that at his death his title passes to the
cadet line in Australia.  Unless he has a son in the meantime."  This
brought laughter, after which the ambassador said in summation: "I do
think it extraordinary that in a nation like ours,

which fought a war of independence to break away from the despotic rule
of King George III, we should now be royalty-crazy.  People magazine
would fade away if they couldn't write about Princess Di and Fergie,
and those tabloids at the supermarket checkouts would vanish."

He became confidential: "I was vacationing in that fine Stanley Hotel
in Estes Park, out in the Colorado Rockies, years ago, when H. G. Wells
and others in Great Britain were agitating for the abolition of the
British royal family.  Some English guests were distraught by the
effrontery of such a suggestion, but one clever Scot among them said:

"Not to worry, my friends.  The King and Queen will never be dethroned.
The people of Iowa would not allow it."  And he was correct.

We have the best of both possible worlds.  The British royal family
belongs to us, too, but we leave all their expenses to the Brits."

When one listener, eager to air her knowledge of matters regal, said:

"Of course, he'll go to Buckingham Palace and the Queen will tap him on
the shoulder with a sword-' St.  Pres quickly interrupted her.  He
explained that such a ceremony takes place only when a new title is
bestowed, and never for the heir of an existing one.

"Then it becomes purely a family affair," he concluded, to the obvious
disappointment of his audience.

And then everything fell apart when an official at the British embassy
in Washington explained that Harry could not inherit the title unless
he gave up his United States citizenship.

When the limitations of his title were explained to Harry, he showed no
disappointment whatever.  When they asked how he could be complacent
about the puncturing of a rather grand balloon, he said quietly: "No
problem.  I've always been a British subject."

"But you told me yourself," St.  Pres said petulantly, 'you'd never
left the United States.  Never been in Britain."

"My father was so loyal to the crown that in Canada he remained a
"loyal subject of the King," as he expressed it.  I remember him taking
me to an office in Ottawa and registering me as a British citizen."

"But you told the man from the embassy that you had American
citizenship."

That's right.  In World War Two I volunteered for the United States
Army, and you have a law which says that any foreigner who serves in an
American uniform fighting against the enemy is entitled to full

American citizenship.  And I accepted it.  So I have dual citizenship,
British by birth, American because of my heroism in battle.  I received
medals, you know."

And so Harry Ingram of the Palms became the legitimate holder of the
baronetcy.  In due course the Palms returned to a degree of normalcy
that had been abandoned during its intense preoccupation with British
aristocracy.  But residents continued to refer to the nondescript
little man as 'our Sir Harry, Bart."

When it became obvious that Betsy Cawthorn would soon reach the point
when she could try to walk completely alone, with no walker, no cane,
no one holding her by the elbow, Dr.  Zorn was so pleased by her
progress that he called Oliver Cawthorn in Chattanooga: "Betsy's done
wonders.  We have this system of parallel bars at handgrip height maybe
two and a half feet apart.  A patient who wants to test her new legs
can walk between the bars and catch herself if she feels she's about to
fall.  With that security, Betsy's been walking, yes, truly walking to
one end of the bars, then turning around by herself, and walking
back."

When Cawthorn expressed his delight at this news, Zorn added a
dampening note: "Remember, technically she is not walking alone.

Those parallel bars close at hand, they're a tremendous help, a mental
crutch.  The big test comes when she stands completely clear of the
bars-with no one to catch her if she falls-and she walks across the
room."

"When might that happen?"

"With Betsy, who knows?  Soon, since she feels it's a personal
challenge."

"Would it muddle things if I flew down to visit with her for the next
few days?"

"I believe she'd love it."

So Oliver Cawthorn flew down to Tampa, visited with his daughter and
took her out to dinner at Berns', the famous Tampa steak house, where,
after the main course, she was handed a menu offering her more than a
hundred different desserts to choose from.  She selected a New

York-style cherry cheesecake and found it delicious.  As her father
helped her to her room that night, she said: "It was a memorable
evening, Dad.  The last of phase one.  Tomorrow I'll be walking.  And
I'd really love you to be here."

On the next day, only a few months after Bedford Yancey took charge of
this crippled girl whose willpower had been destroyed, she entered the
rehabilitation center on her walker, moved easily to the parallel bars,
which she knew she could depend on for support if she needed it, and
stood erect for some moments at the far end of the bars.

Then, smiling brightly at Yancey, her father, Nora, and, especially
Dr.

Zorn, she said with a mock-heroic laugh: "Stand back while I make my
maiden flight!"

With that she stepped forward tentatively, looked as if she might fall,
but then recovered her stability and, with a slow smile illuminating
her face, confidently moved her left foot forward.  Taking a big
breath, she paused a moment to smile at her father and Dr.  Zorn.  Then
with her confidence bolstered, she took a series of steps that were
miraculously normal.  With a cry of triumph and a huge smile she
approached the men who were watching with bated breath.  They half
expected her to end her adventure by precipitately collapsing into
someone's arms.  But Nora, who was also watching, thought otherwise:

She's going to follow this through.

Nora had guessed right, for when Betsy finished her walk, she took
three more steps sideways to where Dr.  Zorn waited.  When she stood
face-to-face with him she threw her arms wide, grabbed him for support
and kissed him fervently.

Nora grinned delightedly, but everyone else who saw her bold audacity
was taken aback, no one more so than Andy Zorn, who recoiled
instinctively and almost unbalanced the girl who clung to him.  He knew
she had a deep appreciation for his saving her life and he had worried
earlier that she might have fixated on him as a sort of savior.

But he also knew that such fixations were common among patients who had
suffered trauma and that they usually passed without doing damage to
either the patient or the doctor.

There were, however, other instances-like the hideous affair of his
friend and colleague Ted Reichert, M.D. Recalling that disaster made
him shudder, and later that day as he paced along the banks of the
channel trying to collect himself, he reflected on how he himself might
stumble into Reichert's snake pit if he allowed chance experiences with
a beautiful young patient to take root and blossom into unforeseen and
uncontrollable passions.

Dr.  Reichert had been the youngest member of the staff at Zorn's
Chicago clinic.  He was an excellent internist, but the older members
of his team quickly noticed that in one aspect of his profession he was
badly flawed: although married to a lovely woman who had given him two
children, he had a fatal propensity for taking his more attractive
women patients to area motels, where there was a good chance he might
be recognized.  Even after he'd had a couple of close calls, with one
irate husband ready to protest publicly, he persisted in his dangerous
behavior.

Andy, as senior member of the team, was given the unpleasant duty of
calling Reichert to his office and reprimanding him: "Ted, you're
fishing in very dangerous waters."

"What do you mean?"  the brash young fellow asked, and his insolence
caused Zorn to lose his temper.  Slamming both hands on his desk, he
snapped: "Damn it all, Ted, you're chasing women patients, dragging
them to motels and endangering your career.  What's equally deplorable
is that you're endangering the reputation of this clinic.  Clean up
your act from this moment on, or'-his voice rose to a shout-'you'll get
kicked right the hell out of this clinic with no letters of
recommendation."

Regretting that he had allowed himself to be goaded into such an
outburst, he softened his tone: "Ted, my dear friend.  The other
doctors and I think of you as one of our best.  We want to hold on to
you.  We want to help you achieve a long and illustrious career, but we
cannot do that if you insist on galloping blindly down the path of your
self-destruction and ours."

Reichert had bristled: "You mean, you've gathered as a committee behind
my back to discuss me?  Who do you think you are?"  and he stomped out
of the office.

Recalling how ineffective he had been that day, Zorn now smiled
ruefully, for his reprimand had had no effect on Reichert.  There were
more women, more motels, more gossip inside the clinic and out, and
finally an outraged husband who dragged the whole sorry affair into the
courts, with gleeful attention from the Chicago press.

So there had been a second meeting, and this time Andy did not lose his
composure.  With Reichert sitting before him like a disobedient
schoolboy, Zorn had said in icy tones: "Ted, you've used up your
credentials in this clinic.  You're dismissed as of this morning."

"You can't do that.  I'll sue you in every court-' Brutally Zorn had
said: "I'd think that you, of all people, would want to keep away from
courts.  Our lawyer assures us we're on safe ground."

At every point at which Ted tried to weasel out of the inevitable, or
plead with Zorn for a second chance, Andy was resolute: "Ted, it's
finished.  Your incredible behavior has cost you your job, your
marriage, your two kids, and your ability to work anywhere in Chicago.
So leave this office and this building and find refuge somewhere far
from here."

He was proud of the way he had kept his temper this time, but when he
was alone, he had suddenly felt sick to his stomach and suffered a
convulsive retching for several minutes, as if he were striving to
throw off a poison that had infected him.

In subsequent years Zorn made himself something of an expert in the
attempts of America's professionals to instill some kind of
selfdiscipline among their memberships.  He noted with approval the
effort in New York to prevent divorce lawyers from having sexual
relations with women clients in a divorce case.  The same held true in
the field of psychiatry.

So when Andy Zorn walked along the channel talking to himself, he was a
man fully knowledgeable about medical ethics, which made him perhaps
unduly cautious about doctor-patient relationships.  There was little
likelihood that he would allow himself to become entangled with a
pretty visitor to the health services of the Palms.

Andy tried to make light of the matter.

"Betsy's just a girl with a schoolgirl crush.  This will all blow over
if I simply treat her like any other patient.  She'll soon have
completed all the rehabilitation we can offer here and be on her way
safely back to Tennessee."  He would not be happy to see her go, for
she had been a bright addition to the Palms, but he would feel easier
if she went.

In the steamy days of midsummer, when Florida displayed its least
attractive weather, an unsavory development at the Palms exhibited one
of those ugly forces to which retirement areas are sometimes subjected.
The two children of the Chris Mallorys, abetted by the strong voices of
four grandchildren, launched judicial proceedings against the elder
Mallorys.  The suit, brought in the Florida courts, was being tried in
Tampa, and charged that the grandparents, through their irresponsible
expenditure of family money, were endangering the future welfare of
their children and grandchildren.  The court was implored to appoint a
legal guardian to oversee how Chris Mallory, the grandfather, spent his
savings, 'lest their radical depletion harm the family."

Andy, who had every reason to believe that Chris Mallory was in full
possession of his faculties, for the man had become an exemplary
resident of the Palms after the unfortunate affair over his driver's
license, felt it his obligation to do what he could to support the
senior Mallorys, and he volunteered to do so.  But when he was about to
announce this decision, administrator Krenek rushed to Zorn's office
with cautionary advice: "Andy, for heaven's sake don't tangle with the
legal system in Florida.  You'll find yourself enmeshed in a jungle
with enemies coming at you from all sides."

When Zorn asked how that could be, Krenek explained from his background
of painful experience in the Florida courts: "Florida does everything
to protect its lawyers.  Easy to understand, since most judges got
their jobs by being lawyers to begin with.

"Andy, you're already asking questions about our doctors.  Don't take
on the lawyers, too."

"But if there's injustice-' "No.  What I'm warning you about is
justice, Florida style.  Stand clear."

"What do I need to be afraid of in the Mallory case?  Looks open
and-shut to me.  Avaricious children trying to gain control of the old
man's money.  Should be prevented."

"It's been my experience in these cases that what seems obvious to you
and me is not at all clear to our judges and juries.  Any family member
may bring a suit like this, and many do; or contest a perfectly sound
will, and God knows many do that-and succeed."

"I thought a will was a will, rock-solid and secure."

Think again!  A will is what the probate court says it is, and the
damnedest evidence can be brought in to upset what's been written in
the clearest possible words and clauses."  To demonstrate his point he
cited a famous case that had involved a large grant to the university
he had attended as an undergraduate.

"Late in life this wealthy businessman had become enamored of astronomy
and had willed his old school quite a substantial sum for building a
first-class observatory.  Such "misuse of family funds" so enraged the
old man's heirs that they brought suit to have the will overthrown.
Protesters crawled out of the woodwork, distant relatives the old man
had never known, but they engineered a formidable challenge.  The
evidence that seemed to have the most effect on the jury was the
substantiated claims that the old fellow had developed the habit of
going out alone at midnight to study the stars.  That proved he was
nuts and not capable of writing a sensible will."

"Surely such evidence wasn't taken seriously," Andy protested, but
Krenek cited an even more serious charge against the old man: "The
relatives brought in a medical doctor who testified that in his opinion
the grandfather's death had been caused by pneumonia he had contracted
during one of his midnight vigils.  The judge asked: "Was that the
behavior of a man in his right mind?"  and when the doctor said "No,"
the jury agreed and the will was overthrown.  The university never got
its observatory, and the relatives split the boodle among
themselves."

"Did they get much?"

"So many of them, from so many parts, they got little.  Lawyers ate it
up before there could be a distribution."

"You think the Mallory gang might be cooking up some attack like
that?"

"I've followed three or four such cases, and no sane man could possibly
guess what charges will be made against our boy, but they'll be attacks
the jury will take seriously, no matter how crazy."

"So he could be in real trouble?"

"Yes."

"So then, I've got to try and help."

Krenek lowered his voice, looked about to be sure no one else was
listening, and warned: "Andy, keep out of this.  If you try to testify,
the Mallory kids' lawyers will make mincemeat of you.  They'll claim
you're only trying to protect your own financial interests.  Suppose
the custodian appointed by the court says that in order to live more
frugally, the older Mallorys have to move out.  You lose the rent on
that big apartment."

"Would they stoop so low?  To dictate where the old people must live in
order to save money for their offspring?  What in hell is the world
coming to?"

"That's exactly what it comes down to," Krenek said, and he summarized,
half a dozen court cases involving disputed wills, a subject in which
he took great interest: "Most fascinating one I remember was the
attempt of the family of the great opera singer Luisa Tetrazzini who
claimed the old lady was going nuts in New York and wasting the money
that ought to be conserved for their use later on.  They marshaled a
lot of wild testimony proving the singer was so certifiably loony that
she must be placed under the care of a guardian-and, of course, they
offered to serve in that capacity."

"How did the case go?"

"Strongly against the old woman.  She had behaved, shall we say,
curiously, but when everything seemed lost she asked permission to
stand in the witness box and without either a page of the libretto or
any musical accompaniment, she sang solo the entire mad scene from the
opera Lucia di Lammermoor.  At the conclusion, so the story goes, the
judge said from the bench: "Madam, you are far from incompetent," and
the relatives lost their case."

It was a chastened Dr.  Zorn who attended the opening days of Mallory
vs.  Mallory, for it soon became clear that a voice of reason like his
was not going to be welcomed in that court.  He was appalled by such
evidence as was allowed, for the young Mallorys produced witnesses who
testified that the old folks, 'in their nineties, were known to
frequent dance halls in which unsavory elements of society consorted,"
and other witnesses too said that whereas they had never seen the
Mallorys in any disreputable hall, 'it was widely known that they were
crazy about dancing and wasted large sums on tickets."

Especially damaging was the testimony of a waitress from a local
restaurant who said that 'the couple often had dinner in her
restaurant, and paid good money for it, even though they were entitled
to a free meal at the Palms."

"How do you know they were so entitled?"  the judge asked, and the
waitress said: "Because they told me so.  One night they said: "This
meal is costing us real money, because at the Palms we've already paid
for our dinner."  ' "Why would they have told you that?"

"Because they wanted to talk.  They told me lots of stuff.  Very free
with their talk, but very tight when it came to tipping."

"You didn't like the Mallorys?"

"I live off tips, not idle conversation."

The lawyer hired by the children asked: "But they admitted they were
wasting money by dining in your restaurant?"

"You could take it that way."

"But you just testified that they told you that, and I quote your
words, "This meal is costing us real money."  Is that what they
said?"

"Yes."

There was other testimony that the older Mallorys were careless
spendthrifts.  A garage attendant said: "They had this good car, a
Cadillac.  Kept it outside their door.  But to go to the restaurants
they always called a taxi."

"Could it be," the lawyer for the old people asked, 'that like many
older people they did not want to risk driving at night?"

"Not at all.  On lots of nights they drove to the mall for some late
shopping.  You know why, in my opinion, they used the taxi when they
went to a restaurant?  Because they had two or three drinks and didn't
want to risk a "driving under the influence" arrest."

This led to evidence from other witnesses that yes, the Mallorys did
like their nip now and then, and yes, they did keep a goodly supply of
bottles in their apartment, where they entertained his bridge devotees
and her friends who helped in the Health building.

"So it's true, is it not, that they were known as "the good-time
Charleys of the Palms?"  ' Those who free-loaded on their booze
sometimes said so," replied a tart-tongued maid.

The children's lawyer made a great to-do about the fact that the Tampa
police had been forced by the old man's erratic driving to cancel his
license.  He not only summoned the young traffic officer who told of
the horrendous left turn that almost caused a pileup on Route 41, a
major highway, but also called to the stand residents of the Palms who
were forced to admit that what the lawyers had discovered by judicious
questioning was true: each of his neighbors had in some way or other
suggested that Chris ought to stop driving.

As he prodded, the lawyer made it sound as if the license problem
sealed his case: "So you yourself, without pressure from anyone else,
without even discussing it, decided on your own that old Mr.  Mallory
was incompetent to continue driving?"  Whenever a witness had to say
"Yes," the lawyer would turn to the jury and shrug his shoulders
slightly as if to say: What can I add?  The old fellow is in his
dotage.

Observing the way the jury seemed to accept the lawyer's heavy emphasis
on the loss of the license, Andy grew determined to intercede on
Mallory's behalf, because what was happening was a disgrace, but he did
get some hint that the lawyer might be outsmarting himself when he
called Muley Duggan to the witness box.  He obviously did not want to
testify, for his answers were grudging and tended to defend the senior
Mallorys, but when the lawyer consulted a sheet of paper and asked:

"Did you not at the Fourth of July gala tell a group of residents at
the improvised bar that you had set up: "That old geezer ought to be
taken off the road, for his own good and ours"?"

Muley remained silent for more than half a minute, a long time in a
courtroom.  Then, turning so that the lawyer and the jury could see his
lips, but the judge could not, he mouthed but did not pronounce two
words: "You bastard!"  and he did it so slowly and with such emphasis
that any knowing person in the jury could read his lips.  Then slowly,
turning back to the judge, he said: "Yes, Fourth of July joking."

"I didn't ask if it was joking," the enraged lawyer said, aware of the
trick Muley had played.

"I asked "Did you say it?"  and Muley said contritely as if scared by
the lawyer: "Yes."  But Andy could see that at least two of the jurors
had caught his unspoken words and had half smiled in approval.

But those two jurors were a slim reed on which to lean in this case,
which involved a lot of money, for Andy had observed that other jury
members seemed to be impressed by the mishmash of rumor, especially the
fact that the Mallorys had dined in a public restaurant when their
meals had already been paid for at the Palms.  He judged that the case
could go against his amiable tenants.

His worries intensified when he returned to the Palms and learned how
seriously the older people were reacting to the danger their friends
faced: "This week it's his money they're taking away, next week it
could be ours," one worried woman said.  Her friend assured her: "But
your children aren't like that.  They're wonderful people, I know
them," at which Muley Duggan, who was listening, growled: "The old
saying was: "Where there's a will, there's a way."  The new truth is
"Where there's a will, there's bound to be a lot of snarling
relatives."  We're all vulnerable when sons of bitches like those
Mallory kids get hungry for whatever savings we have."

This fear was so widespread among the residents that Andy asked Krenek
to join him in his office and said: "Ken, they're crucifying our boy,
and I cannot tolerate it.  Call his lawyer and tell him I'm ready to
testify.  This has to be stopped."

As before, the business manager cautioned against such a public
appearance, especially when the young people's lawyer would be prepared
to tear him apart.  Andy asked: "Are you afraid to make the call?"  and
Krenek deliberated for a moment before replying slowly:

To safeguard the Palms, yes, I refuse."  And he was about to leave when
he stopped, waved his finger at Zorn and warned: "Andy, if you get on
the witness stand, they'll dig into why you left Chicago.  They'll
accuse you of everything and point out that you're not allowed to
practice in Florida.  For your own good, stay out of this."  And he
left.

Alone, Andy reflected on his assistant's advice: He could be right-I
could damage myself as well as the Palms.  But he dismissed the perils
angrily and buzzed for his nurse to join him.

"Nora, they're persecuting the Mallorys, and I feel I have to jump in
and defend them, but Ken advises against it.  Says it might damage me
and the Palms."

Nora considered this advice, nodded her head and said: "Yes, Mr.

Krenek's been here so long he's adopted this place as his own.  Every
decision he makes is to protect the Palms.  But you think also of the
residents.  I like your way better."

"But could he be right?  If I did jump in, could we both be damaged, me
and the Palms?"

"I suppose you could.  But is it injustice we're talking about?"

"Yes.  It's terribly wrong."

Then what choice have you got?  Knock 'em back now."

"Brave advice, but if I get fired, will you come with me to whatever
new job I land?"

"Looks like we're a team, Andy.  I say "Take a shot at the swine."

But then she added: "I'd take those four gentlemen of the tertulia with
you.  They carry weight."

So Andy telephoned the old couple's lawyer and not only volunteered his
services but also promised that he would bring with him when court
opened the next day four very distinguished residents of the Palms who
would certify that Chris Mallory was not only far removed from senility
but entirely in command of his mental faculties.  That commitment made,
he went to the dining room, headed directly to the corner table where
the tertulia was already discussing the case and, without asking
permission, drew up a chair and said bluntly: "Gentlemen, I've taken
the liberty of assuring the Mallorys' lawyer that you four would be in
court tomorrow to help me testify that Chris is competent to run his
own affairs.  It's our duty to stop those avaricious kids."

Turning from one man to the next, Andy asked what each could testify
to, under oath.  The mix of evidence from the four was surprising, for
at some time or another, each of the men had discussed with Mallory a
subject of considerable complexity, and before the dinner ended the
tertulia was prepared to defend their neighbor.

The testimony next morning started with the director of the Palms
giving what he considered an impassioned defense of the old couple, but
when the children's lawyer had his chance to knock down Zorn's
testimony he was ruthless, for they had anticipated that he might
intrude into their case.

"Is this your memorandum?"  It was.

"And in it do you refer to-and I quote your very words-"the Mallory
Yo-yos"?"

"Yes.  It was a phrase-' "I didn't ask for any long-winded explanation.
Did you or did you not describe them as a pair of Yo-yos?"

"I did, but it was only-' "Dr.  Zorn, you had some unpleasantness
concerning your practice in Chicago.  You're not qualified to practice
in Florida, are you?"

"No, but only because I never-' "Dr.  Zorn, as director of the
Palms you would stand to lose a lot of money if the Mallorys moved out,
wouldn't you?"

They've moved out before and we survived."

"But you would lose money, wouldn't you?"

"No."

"What?"

Andy was finally able to squeeze in a point: To the contrary.  When
they moved in they paid in advance for two full years, and that fee is
not refundable."

"But it is in your financial interest to come into this court and
testify that the Mallorys, especially the husband, are competent to
make their own decisions."

That consideration played no part in my testimony."  When Andy tried to
explain, the lawyer said, with enormous contempt: That's all, Dr.
Zorn," with heavy sardonic emphasis on the Doctor.

"We need no more of your testimony."

During this interrogation Zorn noticed that Betsy Cawthorn had found a
seat.  Although he was still wary of contact with her because of the
embarrassing scene in the rehab room, he told himself: Come on, Andy,
she's a patient and a Palms resident, just go say hello.  He left the
stand and made his way toward Betsy.

Her heart skipped a beat when she saw him coming to her, still smarting
from his rebuff in rehab.  She greeted him with a hesitant smile.

"I really hope the Mallorys win this case."

"I'm afraid I'm not helping much," Zorn replied.

"Not at all.  I watched the jurors.  Some of them took you seriously. I
could see it."

"I wish I'd done better, but thank you for your support.  Now I must
see if I can undo the damage I did," and, burning with indignation, he
went to where the members of the tertulia waited: "I'm afraid I damaged
his case.  I'm sorry.  But you guys, you must save this decent old man.
Please."

When Senator Raborn took the stand to stanch the hemorrhage, the lawyer
for the old people asked: "Am I correct in understanding that you
served four full terms as United States senator?  And your committee
assignments during those twenty-four years?"

Twenty-two," and he spread before the court the names of the
illustrious committees on which he had served and the two very
important ones of which he had been chairman.

"In those latter assignments, Senator, you must have dealt with
problems of some national significance?"

"Farm policy and labor policy are almost diametrically opposed, but
they are of importance to the republic, yes."

"Did Chris Mallory, sitting over there, ever discuss such matters with
you?"

"Yes.  He'd been a Republican committeeman from his county and he
continued his interest after he retired."

"Any discussions recently?"

"Yes indeed.  He came to me about a week ago to protest President
Clinton's farm policies, and he had four proposals that would ease the
burden on the big spreads west of the Mississippi River."

"Were they sensible?"

"In my judgment they were better than what the Democrats were coming up
with."

"From such conversations .. . and there were others, I suppose?"

"Many."

"Did you find Chris Mallory to be competent?  Mentally?"

"Extremely sharp.  But of course, farming had been one of his
interests.

I'd expect him to know a lot."

Under cross-examination the senator frustrated the lawyer for the
younger Mallorys by citing a few other other complex fields in which
the grandfather had exhibited mental acuity: "But those discussions
were in the past?"

"If you call two weeks ago the past."

Andy saw, with relief, that some of the jury members had been impressed
by the senator's deportment and testimony, but the surprising highlight
of the morning came when President Armitage took the stand.

After stating his credentials, which were impressive, with the long
list of books published and services rendered to the federal
government, he told of conversations with Mallory that were not much
different from what the senator had testified to.  He must have been
aware of the repetition, for out of the blue he volunteered: "And Mr.
Mallory was of considerable help to me personally, so I had a good
opportunity to evaluate his mental sharpness."

"In what specifics?"

"My wife and I had built up some savings, from my books and speaking
fees, and we felt it would represent a conflict of interest if I asked
the finance manager of my former college to advise me on how to invest
these funds.  So I went to Mr.  Mallory, remembering that he'd been
president of a bank, and he was glad to counsel me."

"And the results?"

"Our college finance team earned us seven percent on the college funds
they invested.  Chris earned my wife and me ten and a half percent,
year after year."

"But did he charge you a fee for his services

"Of course.  He's a canny businessman.  And we were glad to pay it."

Editor Jimenez from Colombia, ramrod straight, with a slight accent,
weighed each word carefully: "Mr.  Mallory frequently stopped me in the
hall to ask about developments in my home country.  He was very
knowledgeable."

"In what way?"

"About drugs.  The Call gang.  The Medellin connection.  He always
wanted to know what they were up to."

"Why would he have such an interest?"

"Because he had served as chairman for his state's antidrug
committee.

He had even gone down to the hill country of Colombia, at some risk to
himself, I must say, because those drug gangs are killers."

"On such a trip what did he learn?"

"Only that Colombian drugs keep seeping into this country, corrupting
our legal system and killing our children."

Now, when the jury looked at Old Aan Mallory they saw an entirely
different kind of man, but the decisive testimony came from Ambassador
St.  Pres, whose credentials were so impeccable and manner so dignified
that whatever he said was bound to carry weight.  He spoke of his
frequent contacts with Mallory, and of the man's interest in matters
besides dancing and dining out: "When the President appointed him to
the national committee looking into the drug problem, Mr.  Mallory had
occasion to visit the centers in the Orient from which drugs were being
sent out to carriers who slipped them into the United States.  Burma,
Thailand, a very rough gang in Malaysia, he knew of them all.  When I
met him at the Palms, where we are both in retirement he liked to use
me to keep au courant with what was happening in the lands he had
visited."

"Did you find him acute?  I mean, did he know what he was talking
about?"

"I was surprised by his mastery.  For instance, he never said "northern
Thailand."  With him it was always "Chiang Mai" or "Lam-pang."  '
Sitting very erect, as if he were being interrogated by the Foreign
Affairs Committee of the United States Senate, he was allowed by the
court to offer a final peroration: "It is trustworthy citizens like
Chris Mallory and his wife, Esther, who form the backbone of our
nation.

They not only attend to their own affairs, brilliantly sometimes, so
that they earn considerable sums of money, but they also serve on
investigating committees, special bodies and the boards governing
universities and hospitals.  To attack them in their later years .. ."
He paused dramatically and concluded: "No, to attack men like the four
of us as we grow older-we'll throw our lot in with the Mallorys-'
Suddenly overcome by emotion, he ended lamely: 'is insane."  The
audience, which included members from various retirement centers in the
Miami-St.  Petersburg area, applauded.  The judge rapped his gavel, not
ferociously, and it was obvious that the jury was deeply moved.

The ambassador's performance was perfect, an effective capstone to the
solid contributions of the other tertulia members.  The lawyer for the
younger Mallorys tried, of course, to impugn the testimony of the four,
but the distinguished witnesses were so skilled in defending their
positions that attempts to denigrate them were easily rebuffed, and
when the jury filed out it was clear that before long they were going
to file right back in.  When they did, after less than an hour of
deliberation, their verdict was in favor of the old people, and it was
fortified by harsh words from the bench, showing that the judge had
been disgusted with the performance of the children of this amiable
pair of old people, of whom Florida had so many.

"Dancing is neither sinful nor wasteful.  Jesus himself attended
dinners in town.  And parents who have educated their children and been
unusually generous to their grandchildren, as the Mallory financial
records proved, have performed their obligations to society.

I judge from what we've heard about the Mallory finances that dinners
and dancing are not going to deplete all their funds before they die.
There'll be a great deal left even for you grandchildren, and my
counsel is to leave this courtroom and not bother to visit the Palms.
Looking at you close up might goad these folks to drop you from their
wills."

Chance dictated that Andy would leave the courtroom just as the group
of younger Mallorys did and he could not restrain himself from stopping
them and saying: "When you reach home I hope you'll read that admirable
story by the Grimm Brothers.  A selfish married couple find it
unpleasant to have to take care of the aging grandfather.  He slobbers
at his meals and spills bits of meat and potato on the table, so his
son carves him a wooden swill bowl like the ones pigs eat from, and
that's the way the grandfather is fed.

"A few days later the father sees his own son, a lad of ten or so,
carving a swill bowl and when the father asks: "What's that for?"  the
boy replies: "So I'll have it handy when you're old."  ' Speaking
directly to the two Mallory offspring and their spouses who had brought
the suit against their father, Andy said: "I hope your children carve
their bowls for you when you get home."  Then he turned away from them
and left the courthouse.

That evening everyone in the dining room looked toward the door where
Chris Mallory and his wife, Esther, were entering, all smiles and
laughter as if returning from a party.  When they waved to friends the
room broke into applause, for they were recognized as surrogates who
had defended the group.

Late in July Andy received an imperative fax from John Taggart asking
him to be in the Chicago headquarters at ten the following day and to
bring with him complete survey and architectural drawings of the entire
establishment, including the road system in the vicinity out to the
eastern edge of the savanna.  These plans were voluminous, but with the
aid of Krenek and Nora, Andy bundled them up and was on the very early
flight to Chicago.

He went to Taggart's office, where a secretary spread the land surveys
on a large clean desk.  Prior to Taggart's arrival, two men whom Zorn
had never met, businessmen apparently, in their late forties or early
fifties, began to pore over the surveys, eager to verify the dimensions
of the unoccupied land south of the Palms.  On the government survey
this land was not specified as the savanna, for that was the name it
had been given locally.  The survey did show the Emerald Pool and the
Heronry, names that must have existed for many years.

When Taggart arrived, he apologized for being late, and introduced the
two strangers as a distinguished architect and an equally well known
builder: "Satisfied with what you see, gentlemen?"

When they nodded emphatically, he turned to Zorn and said: "Exciting
news, Doctor.  These men, with the enthusiastic support of two of our
leading banks who will lend us the money, are prepared to move
immediately into this big spread of open land, which we already own,
clean it, dig a series of four interlocking lakes, lay down a complete
road system, and build for the Palms a collection of-how many at last
count?-forty-eight spacious duplex apartments-that is, two side by side
on the same concrete slab-for the occupancy of those older people who
are ready for a kind of retirement, but who do not want to surrender
their right to an individual home.

"In this way we get nearly a hundred well-to-do people, members of the
Palms family, who will later move into Gateways, then into Assisted
Living and ultimately into Extended Care.  It's the wave of the future.
We see it wherever we look, and we're planning six other such
extensions in our better operations.  You, Zorn, are to be the
groundbreaker, and if this partnership can plan and build what amounts
to a new community, from the ground up, they can assure themselves of
many similar commissions."

Zorn was astounded.  If the land contiguous to the present buildings
was to be cleared to make way for the duplexes, it would mean the loss
of that part of the savanna used by the residents of Gateways and
probably the loss of the Emerald Pool, too.  He felt that he must
protest in defense of his clients who had bought into the Palms with
every right to believe that the ground to the south would remain open.
How many residents were there like Ambassador St.  Pres and Reverend
Quade, Laura Oliphant and Judge Noble, who loved the African mix of
trees, shrubs, pampas grass and hidden pools?

"Mr.  Taggart, do you think that the present residents of Gateways will
feel that they joined us with the expectation that the savanna at their
doorstep would remain open land?  Was there any promise in the
contract, or one that was implied?"

"None.  They bought into the Palms with our assurance that the river
would remain on the north, the channel on the west, and there they
are.

What happens to the east has already been decided by the community, a
big mall, and we decide what happens on our land to the south.

Private duplexes for the new wave of patrons."

Now the builder spoke for the first time: "We won't slash and burn, or
ignore sensible spacing standards, or fail to keep enough open spaces.
We're bound by very meticulous zoning codes.  Everything we do is
subject to inspection to see that we live up to those codes."

"Andy," Taggart broke in, 'do you think we'd build something on your
doorstep that would in any way depreciate the value of the Palms-a
value you've reestablished?  This addition is going to be far more
state-of-the-art than what you have already.  Look'-the two strangers
spread their own blueprints and sample drawings of a duplex.  Taggart
pointed to the amenities in their plan: "A recreation building up here.
And along the channel, an esplanade."  Zorn, inspecting, saw that Judge
Nobel's steel-reinforced chair was gone, and it looked as if the
Emerald Pool and the Heronry would also be obliterated, but when he
asked about them the men said: "We'd be insane to lose them when we
have to build two other lakes from scratch.  Those two big areas are
your present pools, enlarged."

"Explain how you move a long-armed backhoe up to the edge of an
existing pool," Taggart said, 'and scoop it out like you were serving
ice cream."  Zorn saw that the four pools included in the plans were so
spaced that the duplexes scattered about the edges could be sold for
additional charges.

"We expect one half of a duplex to sell from $210,000 to $380,000 along
the waterfront.  And with these prototypes we'll start selling right
away," Taggart said.

"We'll move Henderson down next week-very foreceful salesman, he'll
have half the condos sold before they're finished."

"And when do you estimate that to be?"

Taggart looked at the two men and the architect answered: "Land cleared
in one month.  Infrastructure in second month, and by that we mean
roads, sewers, lights.  Grade and pour the twenty-four double slabs,
third month, and finished houses five months after that," and the
developer said: "Remember, in Florida you can work outdoors twelve
months a year.  By this time next year, we'll be off working on some
other site."

They now explained in detail the features of the duplexes and how no
two, which would be twins on their slab, would be identical with any
other pair in appearance or orientation.

"We're building for beauty, for permanence," the architect said and the
builder confirmed this: "Highest quality in details," and he rattled
off the famous brand names of kitchen cabinets, bathrooms, floor
coverings and electric lighting.

"When we're finished, you'll want to buy the first duplex, Dr.

Zorn."

Zorn felt suffocated by the detail these skilled men threw at him, but
when they were finished he had to ask, almost plaintively: "Why wasn't
I told about this sooner?  You've made so many decisions," and Taggart
had an excellent answer: "Because we were not planning for only one
site, wonderful as yours is.  This double-sized slab is going to be
used in our holdings in the other hot states like California, Arizona,
New Mexico and Texas.  And we have just as fine plans for the states
where we have to build with cellars."  He tapped the blueprints: "It
was touch and go, Andy, whether we'd build this trial run in your
Florida showcase or the big development Harry Cain operates for us near
San Diego.  You won because you're farther along in whipping the Palms
into shape."

He interrupted himself to tell the men: "Dr.  Zorn has worked miracles
down in Tampa.  He's two years ahead of the schedule I posted for the
place.  When you build in his backyard, you're associating with the
best."

At lunch the four men continued their discussions, with the other three
assuring Zorn that the Palms West, which was the name Taggart had
settled upon, would enhance both the look and the reputation of the
retirement area: "It's the wave of the future, Andy.  Four-step
offering instead of three.  You watch.  Retirement areas that cling to
the old style, with no single dwellings for the early retirees, will
fall by the wayside."

When Zorn pointed out that whereas the Palms West sounded rather
attractive the proposed development would actually lie to the south,
Taggart said with great conviction: "South does not sell in real
estate.  It carries a connotation of moving away from the main action,
a sense of retreat.  West is always good.  Moving toward the noble
traditions of the nation.  West sells."

After lunch Andy hurried to O'Hare, where he caught a plane back to
Tampa, bringing with him a hefty packet of new blueprints, plans and
drawings depicting the future of the Palms.  He went to bed exhausted,
but was wakened early the next morning by Ken Krenek and Ambassador St.
Pres, who wanted to know what was happening out in the savanna, and
when he joined them to inspect what had taken place while he was in
Chicago, he was astonished.  The low woodland was covered by a blizzard
of three-foot stakes with one of three different colors at their tips
indicating future use: red for the proposed roadways, blue for the
waterways and bright yellow outlining the twenty-four concrete slabs,
each of which would contain two duplexes.

And off to the west, where the channel ran peacefully, there stood a
row of black stakes indicating the paved promenade that would rim the
waterfront.

"What in the world are they proposing?"  St.  Pres demanded, and Andy
explained the concept of the Palms West, which would bring ninety-six
new residents into the complex.  At this point a crew appeared to
install along the highway a huge billboard that proclaimed:

THE PALMS WEST.  DUPLEXES FROM $210,000.  Well inside the area a semi
hauled a long prefabricated building already decorated as a compact
sales office; and four monstrous bulldozers moved in to sculpt the land
in conformance with the dictates of the colored flags.  One of the
bulldozers had a huge claw projecting from the rear, and it started
digging out what would become the first of the ponds around which the
more expensive houses would be built.

Rattler was infuriated.  And when that happened he was big enough and
deadly enough to do something about it.

His problem was twofold: he hadn't eaten for two weeks and was
starving; and the lush savanna stretching to the north of his den in
which for so many years he had hunted rewardingly for rabbits, mice,

birds' eggs and a multitude of little creatures was being scraped clean
by the big bulldozers that were clearing the land for the condominium
soon to be erected there.  Social progress had caught up with the great
rattlesnake, and he did not approve.

On a very hot afternoon in August he remained close to the Emerald Pool
protecting himself from the destructive sun by hiding in his den amid
the roots of a few small trees and bushes that had been left standing
by the planners of the new buildings.  But if he was relatively
comfortable in his retreat, he was not content, for he was suffering
acute pangs of hunger.

For the present he refrained from going out to seek food; he realized
that if he was exposed to the burning rays of the sun for any
considerable period, he would perish.  Had he had a voice he would have
howled in frustration; instead he coiled himself into his combative
position and prepared to take action, but what specifically he might do
he did not know.  What was certain was that any object, man, animal or
a force unknown, that came into contact with him in the next hours was
in mortal danger.  He would be on the prowl, a deadly opponent.

So he waited in his refuge until the sun had departed, leaving cool
shadows in which it would be safe for him to go hunting.  Thrusting his
delta-shaped snout out into the fresh air, he sensed a most enticing
opportunity: there was activity in the Heronry some distance to the
northeast.  His supposition was based on various bits of data.  Big
adult herons were flying so close to him overhead that he could see
them carrying fish in their beaks.  Normally the birds would have eaten
the fish right after catching them; if they were bringing them inland
it must be to feed their newly hatched young.  He smelled new odors
drifting in from the Heronry, in which traditionally the big birds
reared their young, and on previous night excursions he had heard
coming from the birds' breeding place unusual sounds, perhaps of young
begging for food.  There was also in the air a smell of the feeding
process.  For all these reasons, a daring trip to the Heronry seemed a
good risk with a promise of something to eat.

But if he slithered away from his den he faced an entirely new risk,
one that had recently arrived to endanger him.  When the noisy
bulldozer had moved across the savanna, reaching with its destructive
jaw only a few yards north of the Emerald Pool, it had scraped the
earth flat, knocking down trees and uprooting and killing all grasses
and

shrubs.  And it had continued the process of annihilation all the way
north to the highway and east to the line of buildings.  Within a few
days it had converted the savanna with its many nooks and crannies into
a barren dusty waste that provided no refuge to any living creature,
from tiny mouse to gargantuan rattlesnake.  During the first moments of
this evening's foraging, Rattler would have to leave the reassuring
grassland surrounding the Pool and risk his life in crossing the arid
dry land

Furthermore, when he reached the Heronry he would face not a nestful of
baby birds, whom he could gobble up one by one, but a pair of adult
blue herons capable of destroying any animal threatening their nest.

Through the years he had often seen the big birds, sometimes grave and
stately, at other times awkward and clumsy, prove to be deadly if a
snake exposed himself to the powerful stomping of their heavy, hornlike
feet or the piercing jabs of their long, sharp beaks.  Three jabs,
properly placed, could kill even a large snake, so this venture to the
Heronry was no casual expedition.  It was a choice between certain
starvation or possible death.

When assured that the sun had gone down, he cautiously left his den,
twisted his head left and right to see if perchance some stray rabbit
or large mouse had happened by to provide a meal, which would make the
trip to the Heronry unnecessary, and somewhat reluctantly brought the
full length of his massive body from its hiding place and started for
his goal.

He was a monstrous snake, almost nine feet long, fourteen inches in
circumference at his fattest part, and with a huge assembly of rattlers
on his tail.  If he wanted to sound a warning by activating them, he
could be heard for many yards.

His mode of travel, perfected over many million years, was unique in
the animal kingdom: he had no wings so he could not fly; he had no feet
so he could not run; he had no fins so he could not swim; and he had no
legs so he could not leap.  But what he could do, almost magically, was
send nerve messages to the various segments of his extended body so
that they responded in ways that allowed each part to edge forward,
inch by inch.  If so inspired, he could slither forward almost as fast
as a man could run.  He was a relic from some ancient past, and the
fact that he carried in his fangs a deadly toxin converted him from a
harmless snake, of which there were a hundred varieties,

into a lethal torpedo, an animal constructed to kill efficiently.  When
he was in motion, he was as potentially destructive as an army on the
march, but he was so deadly that nature had slowed him down by imposing
a most curious rule: he could not strike his enemy when he was fully
extended and moving forward; he must stop and wind his fearsome length
into a coil so that the full weight of his body could be used to spring
forward three or four feet, allowing the deadly fangs to fasten into
the body of the victim.

And, strangest of all, he had been constructed by the forces that
devised him with a serious impediment: he could not strike without
first sending a loud, clear warning from the rattles in his tail.  The
sequence was invariable: Stop, coil, signal noisily, then strike.

It was this snake, veteran of a thousand attacks on others, survivor of
a hundred assaults upon itself, that approached the Heronry.

Great blue herons had lived for untold generations in what had become
known to human beings, late on the scene, as the Heronry, but that was
in the days before bulldozers had been invented or condominiums
conceived.  The grassy savanna had extended unopposed north to the
river, east to undefiled lands and south three miles to another body of
sluggish water called the Bayou.  It was an ideal place for herons to
breed and many did, but within the last month the herons had a year of
contiguous periods when nature gave unmistakable signals that 'now is
the month to breed' and 'now is the month to make the babies leave the
nest' and 'now is the month to visit these other fishing grounds'-the
birds had been assaulted by a series of unparalleled confusions: noisy
men had come painting signals on the trees, great machines had appeared
to scrape the earth clean of grasses and shrubs, and for a few
dangerous weeks it looked as if the huge machines were going to erase
the Heronry, but other humans in green uniforms had come to drive
stakes some distance from the area and call to one another: "We'll save
this and hope the birds will stay."

There had been jubilation among the ones in green when the herons built
their nest.

But now, as night fell, the mother heron experienced a wave of unease.
Always attentive, she thought she detected a slight movement amid the
patch of grasses that had been spared by the machines, but when she
moved a short distance from the nest to investigate, she could see
nothing and concluded that at worst it might have been a mouse, from
which she had nothing to fear.  He might come by when the nest was no
longer in use, to clean it up and maybe take a few small sticks for his
own use, but he could not damage the nestlings.

But it might also have been a rat with long, fierce teeth, and that
could be dangerous, for rats were determined predators with the power
to create havoc in a nest.  They too, however, could be defeated by two
determined adult herons with their powerful feet and sharp beaks.  The
mysterious creature in the grasses could not be one of the most
dangerous enemies of all, a water turtle who caught baby herons, and
adults too, by coming at them from the bottom of some stream, catching
their long legs underwater and pulling them down until they drowned and
became food for the other turtles.  The mother heron need not take
precautions against the voracious turtles till she led her fledglings
to the channel.

But just as she was about to dismiss her fears about a lurking danger,
she saw in the gray twilight a sudden flash of iridescence and the
appearance of a hideous, triangular head with gaping mouth attacking
her nest and catching one of her babies-the chick's head deep within
the jaw, with the rest of the small body dangling out.

When the mother heron uttered a loud cry, her mate came rushing through
the savanna grass, aware that disaster of some kind had struck. Without
hesitation the male heron leaped right at the rattler's head, striking
it with his long, incredibly sharp beak, while the mother heron took
her stance near the nestlings and launched her attack on the extended
body of the snake.  Neither heron accomplished much, for the rattler
was able to slither his body so adroitly that the long spikes of the
birds' beaks missed their marks.  Freed for a moment, the snake started
his reluctant retreat, with his mouth immobilized by the long legs of
the half-eaten bird dangling from it, but the herons continued their
attack until the battleground had moved a safe distance from the nest. 
The mother bird, satisfied that she had repulsed the invader with the
loss of only one chick, returned to the nest to protect the other four
from any other assailant who might attack in the confusion. She had
finished with the rattler, gratified that she had at least once sunk
her powerful beak into some portion of his cold body.

But the male heron, the inheritor since birth of a fear of the dreadful
snake that could destroy an entire nestful of young birds, maintained
his attack on the retreating foe, stabbing at wherever the grass was
moving and trying to anticipate where the reptile would next be visible
in the fading light.

Rattler now had a new set of problems.  His raid had started as a
success, but now, as he tried to retreat, other herons flew in to
assist the original pair and he found himself assaulted from all sides.
Some of the flashing beaks were beginning to do damage along the entire
length of his body.  Frightened, he managed to dispatch signals to all
segments, and when they responded, he was able to slither in a dozen
different directions at once, confusing the birds and allowing him to
make his momentary escape into the deep grass near the Heronry.

He had, however, not counted on the fury of the male herons, who showed
no signs of halting their attacks.  Pursuing him as he tried to hide in
the grass, they stabbed at him incessantly until he realized with
horror that he ran a real risk of being killed.  His problem was that a
heron was built in such a way that there was no vulnerable spot for a
snake to attack.  The bird's plump torso, normally an inviting target,
was covered with slithery feathers which his fangs could not penetrate,
so attack in that direction was futile.  Even more discouraging were
the thin legs of herons, not the fleshy targets customary on other
animals but tall spindly sticks composed mostly of gristle and bone,
impervious to attack.  In no sense was Rattler dominating this fight.

As the menacing beaks continued to torment him, he sensed a rabbit
nearby and, searching instinctively for this tasty morsel, found its
warren, a deep hole in the ground.  Trusting that the cavern would be
big enough to hide his full length, he darted into the hole and
terrified two rabbits who were living there.  Fortunately for them, the
warren had another exit through which they fled, aware that they had
looked directly into the eyes of death not six inches from them.

The herons, frustrated but aware of where the snake was hiding,
maintained a watch over the warren, and in this manner the long night
ended, with the birds having protected their nest with only a minor
loss.  Through the heat of the following day Rattler remained in the
warren, slowly digesting the baby heron and dozing off at intervals.

The warren was cramped and his huddled position uncomfortable, but he
had no alternative except to stay until the fierce noonday sun began to
leave the sky and the protection of a cooler evening approached.

Finally, when darkness provided at least a minimum of cover, the great
snake edged his head out of the warren, found the air properly cool and
the light minimal, and was encouraged to drag his entire nine and a
half feet out into the late twilight.  Remaining in the grassy area for
as long as possible, he came at last to the spot from which he must
make a dash across the barren ground, but at this moment a seagull,
that rowdy scavenger of the sky, spotted him and raised a commotion,
which brought back the herons.  For fifteen desperate minutes a deadly
fight exploded on the edge of the grass, with needle-like beaks
slashing at the exposed snake and his poison fangs striving to find a
target.  But as darkness deepened, the herons were satisfied that they
had repulsed their enemy and were content to let him escape.

A full twenty-four hours after leaving his den on his perilous
expedition, Rattler waited till the herons flew off, then ventured
gingerly out onto the barren land.  Drawing upon all parts of his
enormous body, he slithered as fast as he had ever done across the
sandy soil, still heated from the daytime exposure to the sun, and with
a final burst of speed left the dangerous open ground, sought the
grassy area around the Emerald Pool and almost dived with relief into
his rocky den.

The food he had obtained at the Heronry would last him for about two
weeks, in which time he might catch a rabbit or some small ground
animal whose body would provide nourishment for some additional days,
but inexorably the time would come when he would once more have to go
foraging.  And as the bulldozers continued to lay waste the savanna,
the area in which he was free to operate grew smaller and smaller.
Every day the space required for the new condominiums attached to the
Palms constricted the domain he had terrorized for so many decades,
but, like any astute elder statesman, he would face that problem when
he had to.  In the meantime he needed sleep.

Because John Taggart had decided, early in his business career, never
to tolerate social discrimination in any form, the Palms had an
interesting mix of the American population, encompassing all the groups
sometimes excluded by similar retirement centers: Jews, blacks and,

especially in his western establishments, Orientals.  Thus the Palms
housed three black couples, one mixed marriage and everyone's friend
and confidant, Judge Lincoln Noble, a widower.  The selection of staff
was also color-blind: the cooks were evenly divided between black and
white, male and female; the nurses in Health tended to be female and
black but there were also many whites; and the dining room waiters were
again about evenly mixed between the races and the sexes.

There had never been, in the history of the Palms, any discord between
the groups, partly because top management would not allow it to
develop, not even in whispers, and partly because any black worker or
resident could see that one of the powers in the organization was Nurse
Nora Varney, who could spot and then neutralize any incipient trouble.
If some black waitress felt that she was unjustly getting the more
difficult tables to serve, she had to take her complaint to Nora
Varney, who listened patiently and tried to clear the difficulty.  If,
however, the complaint was unwarranted and had nothing to do with race,
the big black woman would amiably tell the girl: "I can point to three
white girls who have table assignments just like yours.  Next session
you'll get one of the better ones."

In the kitchen there was a demon pastry chef, worth his weight in
platinum, a black fellow twenty-six years old whose father and uncle
had been pastry chefs in Tampa restaurants.  Luther Black was a tall
young man, attractively slim and blessed with a disposition that kept
him smiling most of the time.  He had a fund of rural Southern sayings
with which he salted his animated conversation: 'as nervous as a long
tailed cat on a porch filled with rocking chairs' and 'my doughnuts
started out all right but I must have deep-fried them in rancid bear
fat instead of Crisco."  He was such a treasure in the kitchen that Ken
Krenek had quietly given him a series of raises in pay and increased
authority.

Among the personnel who appreciated his unusual qualities was one of
the high school waitresses, who saw in him a charming, stable young man
who was bound to go far in whatever branch of the food business he
elected to work in.  She was especially impressed by his steadiness,
because she was the daughter of a broken family commonly classified as
'po' white trash."  Her father was a feckless South Carolina cracker
who had abandoned his wife and children and contributed nothing to
their upbringing.  As early as possible, she had fled what she called
'our ratty dump," had emigrated to Florida by herself and found both
employment and a good high school.  Lurline White was a survivor, a
tough-skinned Southern girl, eighteen years old and determined never to
slip backward into the kind of life represented by her pitiful father
and her miserable mother.

As she moved among the tables, ingratiating herself with everyone and
doing twice as much of the heavy labor of toting and distributing
dishes loaded with food as the others, she became recognized as 'the
best of the lot," and Krenek secretly slipped her bonuses.  One
afternoon he promised that if she continued to work at the Palms after
graduation, he would see that she was promoted to one of the major
jobs: "Lurline, you could be the mistress of the entire dining room.

And if you handle that properly, as I know you would, one of the big
hotels on the beach would want you.  Think it over."

On the evening he told her this, she returned to the miserable room she
shared with two other white girls, who were then at their jobs as
waitresses in bars, and sat alone, contemplating the bright future
Krenek had painted.  When she saw that she truly had a chance to escape
the wretched life she had known up to now, she started to cry.  She
thought: Thank God for Mr.  Krenek.  Thank God that he saw how hard I
was working.

Then, as she sat on the edge of her bed, for the room had no table and
the two chairs were piled with clothes because it had no closets
either, she dried her eyes and coolly surveyed her life.  She was
confident she would do well as a worker because she had always been
industrious and competent.  But what about her personal life?  She
thought: I want a family-a real family!  With the help of God, I want a
husband who's loving and strong and who will help support the kids. Not
like Daddy.  Daddy .. . why did I have such a rotten father!

Eleven o'clock came and she still had not turned on the light to do
tomorrow's homework in math, for she was deep into more vital problems.
As she reflected on her parents' failed marriage, to be blamed mostly
on her worthless father, it seemed natural that her thoughts turned to
Luther Black, the pastry chef with the winning personality, who was the
exact opposite of her father.  He was strong where her father had been
weak.  He liked people while her father had been a surly brute.  In
thinking romantically about Luther, she did not once consider the
staggering problem that he was black and she white;

she had progressed in her evaluation of life far beyond the traditions
of her parents, who referred to blacks most often as 'those goddamned
niggers."

She kicked off her shoes and started to undress for bed.  But then,
because she knew that it was obligatory for her to maintain a high
grade average so that her high school record would look good-and she
might even want to go to college-she got out of bed, turned on the
light, cleared one of the chairs of its pile of clothes and tackled the
beautiful mystery of:

4x + 2y = 22 x + 2y = 16 Subtracting the bottom equation from the top,
she saw that the y's canceled out, leaving her with the final equation
3x = 6, or 2 for the value of x, 7 for y. Triumphantly, she placed the
clothes back on the chair, turned off the light and fell asleep.

In the morning she faced the ticklish problem of how to hint to her
pastry chef that she would not be averse to any interest in her that he
might want to express, and when she gave rather blatant signals to
which he did not respond, she found the courage to tell him one
afternoon: "They say that the old Marx Brothers film A Night at the
Opera is very funny.  Maybe we ought to give it a try?"

Luther Black had been aware for some time that the blond waitress from
Central High was not only one of the best but was also interested in
him, but to what extent and within what limitations he could not guess.
He knew her primarily as a girl who had moved down from South Carolina,
a state with Old South traditions on which he did not wish to trespass.
He knew further that he had bright prospects at the Palms, and he
could not anticipate how the management would look upon one of their
black employees daring to date a white girl.  He had therefore
carefully refrained from sending Miss White any reciprocating signals,
but he did have to laugh at the position in which he found himself:
"Mr.  Black, very black, disturbed about Miss White, very white.  Fate
gotta have a hand in a mess like this."

But now that she had broken the ice he felt differently: She's the best
of the lot, by far, and I'd be proud to escort her to the movies.  Then
a more serious thought struck him: I'm the best cook in these parts.  I
can get me a job whenever I want one.  So if Krenek and Zorn don't like
me dating one of their white girls, let them fire me, and to hell with
them.  He told Lurline on her next visit to the kitchen: "Hey, let's
take a look at that movie," and boldly they did.

The couple was astounded at the way the Palms reacted to their
courtship.  Krenek and Zorn barely noticed; they took it as a matter of
course that their attractive waitresses would date boy waiters and
kitchen staff.  The dining room patrons, knowing what an exceptional
young woman Lurline was, expressed their pleasure that she had found a
young man.  There must have been some among the many couples in
Gateways whose inherited prejudices made a black-white romance a bit
difficult to accept, but since they were aware that voicing any
opposition would be contrary to the center's policy, they said
nothing.

When the courtship intensified and the day came when a wedding could be
announced the Palms swung into maximum activity.  The older women,
especially the widows, greeted the news with delight;

many remembered their wedding day fifty or sixty years ago as the most
meaningful day in their lives.

"So much depended on it," one widow said.

"It was the beginning of my real life, and a day as sacred as that
ought to be celebrated with pomp and joy."

Felicita Jimenez, who had happy memories of the gala weddings in
Colombia, took charge, with the approval of the other women, of how the
marriage should be honored: "It's got to be held here in our recreation
room.  After all, it's a Palms affair, they met here and courted under
our very noses.  That's decided."  And she allowed neither the
prospective bride nor the groom even to suggest an alternative: "We'll
give them a wedding they'll cherish the rest of their lives."

She appointed a flower committee, a music committee and a refreshments
team.  She wheedled eighty dollars from Miss Foxworth and appointed a
committee of three, headed by Senator Raborn's wife, to organize
showers for the bride.  Sentiment in favor of the marriage was so
unanimous that gifts of considerable value were contributed.

And then came the problem of who would perform the actual ceremony.
Felicita assumed it would be Reverend Quade, who was not only willing
but eager to do so, for early on she had identified Lurline White as a
superior girl: "I would feel privileged to help launch her into her new
and exciting life.  I see rocky times ahead in even a perfect
white-black wedding, so let's all give it our most heartfelt
sanction."

Felicita was relieved that Mrs.  Quade felt that way.

But Luther upset everything: "I'd like to have Judge Noble in the
ceremony.  He's an honored gentleman and it would be proper."  As soon
as this preference became known, hidden animosities surfaced:

"You'd think he'd be proud to have a distinguished minister like Helen
Quade perform the ceremony.  Anyway, is Judge Noble qualified to do
it?"

Felicita Jimenez was both vocal and loud: "Isn't it the woman's right
to select the priest for her wedding?  Comes once in a lifetime.  It's
the girl's prerogative, and I think it's disgraceful that a man should
try to give orders even before the wedding starts.  It's a bad omen,
believe me."

When Reverend Quade heard of the fracas, she did what her friends would
have expected: "I understand Luther is a fine young man, a proud one,
and if he feels that it would be proper for a fellow black to
officiate, it's no problem with me.  I get far too many weddings and
burials as it is."

But when Luther heard that Reverend Quade was withdrawing he was
aghast: "Hey!  I didn't mean Noble should perform it alone.  I meant he
should be in on the deal.  I saw on television where a rabbi and a
Catholic priest married a young couple.  Side by side.  Why couldn't we
do the same?"

When this suggestion was circulated, even the most skeptical applauded:
"Just the way it should be.  We don't have two better residents than
Helen Quade and Lincoln Noble, or two nicer young people than Lurline
and Luther."  Judge Noble, when approached by friends, said publicly he
would be honored to stand beside Reverend Quade on such a joyous
occasion.

A few newspapers along the west coast reported on the forthcoming
wedding, playing up the oddity of a black Mr.  Black marrying a white
Miss White, and television crews sought permission to attend the
ceremonies.  One male columnist at the Tampa paper submitted an essay
for the Op-Ed page:

I've lived to see the whole circle.  When I was a student in Haverford
College in suburban Philadelphia a beautiful young

woman named Foot married a young man named Hand, and the papers
reported: They were bound, Hand and Foot."

Tomorrow our column might read: "God intended them to be joined, Black
and White."

In this swell of amity, the wedding was solemnized in the recreation
room with fellow cooks, white and black, attending Luther, and fellow
waitresses, also of mixed color, coming down the improvised aisle as
bridesmaids.  Before the far wall the two officials waited, Helen Quade
as tall and dignified as ever, Judge Noble stately and solemn.  They
had agreed upon an eclectic ceremony with passages from the lovely
Episcopalian ritual, others from the legal rites performed by justices
of the peace, and a reading from Kahlil Gibran.  A choir of nurses from
Health sang Negro spirituals, and those couples from Gateways who were
fortunate enough to have survived together into their seventies or even
eighties held hands and fought back the tears.

Dr.  Zorn, who had insisted upon serving as Luther's best man, chanced
to look across the crowd to where Betsy was dabbing at her eyes with a
handkerchief and he thought: I want to be sitting with her, and his own
eyes misted over.

For some weeks in the late summer, Dr.  Zorn had noticed that Nurse
Varney appeared listless in the late afternoons as if overcome with
fatigue.  Since he knew from close observation that she was not
performing any more tasks at the Palms than before, he had to conclude
that she must be moonlighting at a second job.  He could not believe
that she was doing this only to augment her salary, for she was being
paid top dollar for her important contribution, but he did not dare ask
lest she take offense.  He was all too aware that she was, as Ken
Krenek had once stated, the most valuable person in their operation.

So although Zorn was reluctant to query his nurse about a possible
second job, he felt he should know what was happening because it could
impair her work at the Palms.  One morning, with trepidation, he asked
in a carefully casual tone: "Are you getting enough sleep, Nora?

I'm worried about you," and she knew he had spotted the change in her
appearance.  At first she denied there were any problems, but when on
the second day he said: "I want Dr.  Farquhar to take a look at you,"
she could no longer keep her secret.

"I have obligations."

"Your major obligation is here.  You must report here fully rested,
it's only fair to us."

Firmly but not contentiously she said: "Maybe my obligations there are
as important as those here," but when she saw him stiffen at this
rebuff, she regretted her curt response and said tentatively: "I think
maybe you'll understand.  I think you have heart as well as brains."

"Understand what?"

"Could you spare half an hour?  Right now?"

"For you, yes.  Of course."

Taking her car they left the Palms, drove east along 117th Street,
turned left on Superhighway 78, crossed the bridge, drove through the
cypress swamp and into the southern reaches of Tampa.  Dodging down
side streets, she took him into a jumble of broken-down warehouses
intermixed with mean culs-de-sac lined with obviously empty three-story
houses whose windows had been broken and front doors ripped off for
firewood.

"What is this?"  Zorn asked, and Nora replied: "End of the world,
gateway to hell."  And as she pulled up to a curb she offered a solemn
confession: This is where I've been spending my nights."  Knocking on a
half-broken door, she said: The other side of medical practice."

The door opened and a surly woman dressed in a heavy man's sweater led
them up rickety stairs with frayed carpeting.  She took them to a tiny
room on the third floor, and from the moment she kicked open the door
without knocking, Zorn saw all he needed to know about that room: from
the facing wall two large areas of plaster had worked loose from the
laths and fallen to the floor, making the wretched room look even more
desolate and forbidding.

On a cheap metal bed in the far corner of the room, jammed in beside
the lone window, lay a very tall, emaciated young black man who once
must have been handsome, for he had a face with strong chiseled
features and deep-set glowing dark eyes.  Even in his present condition
he looked as if he could have been an athlete.

Against his better judgment, Andy Zorn again became a doctor, for

automatically he leaned down to take the stricken man's pulse:
"Is it what I think it is?"

"Yes, AIDS," the young man whispered.  At this terrible word Zorn drew
back because, coming from those withered lips, it sounded doubly
horrible.  Nora explained: "Jaqmeel is my nephew, my brother's boy.

Basketball scholarship to the university at Gainesville.  And this
happens."  She elbowed Zorn aside and took the young man's hand.

Zorn asked: "Are you pretty good at the game?  I should think you might
be, with your height and all."  He used the present tense purposely, as
if there were a chance that Jaqmeel might one day miraculously recover
and play again.

"Fair."

His aunt could not accept this depreciation of his ability.  Taking
from her purse a carefully folded clipping from a sports page, she
showed Zorn a full-length photograph of a six-foot-four university
basketball player in a uniform that displayed his two hundred and
twenty pounds of aggressive muscle: "He was the star.  What they call
the point guard, rather big for that job, but very quick in his
movements."

Zorn had the grace not to gasp at the horrendous difference between the
photo and the figure huddled on the bed.  The first was a giant oak
tree, the second a shriveled reed.  Nora, eager to have Dr.  Zorn
understand how extraordinary her nephew was, used basketball jargon she
had picked up from him: "With him so tall and strong in those days, he
made himself a master of the in-your-face slam dunk," and this made
Jaqmeel smile wanly.  Then he said: "I'm nothing now," with such grim
finality that the doctor shivered.  In an awkward effort to maintain a
conversational tone Zorn asked: "How far did you get toward your
degree?"

"It was mostly basketball."

Again his aunt would not allow such an evaluation to stand: "Two years
of excellent work, mostly A's and B's.  His professor told me Jaqmeel
could go on for a master's."

"In what?"

The emaciated young man, not eager to relive his days of glory,
mumbled: "He thought I could go into college teaching.  Black
history."

Admiringly his aunt said: "Jaqmeel could do it.  He speaks well, none
of that "all peoples gots" that you teased me for," and Zorn could see
from the way she looked at the young man that she loved him and had
marked him as the member of the family who would really make it in the
white man's world.  To her, his loss would be tragic.

Dismissing somber thoughts, he again became a doctor, "First thing we
must do," he said brightly, 'is get you out of this dump."  Turning to
Nora, he asked: "Where can we take him?  Don't worry about the money.
Something can be arranged."

"No one will take him," Nora said.

"Even if you have the money."

Zorn could not accept this: "There must be something available.  This
is the United States.  We don't throw people into the streets-or into
places like this."  He took it upon himself to call downstairs: "Ma'am,
can you give me some help?"  and when the frowsy woman climbed
protestingly to the third floor, he asked: "Could you tell me if
there's a place with medical care that we can take this young man?"

There ain't any."

There must be, in a civilized place like Tampa."

The woman looked at Nora, then shrugged her shoulders: There is one
place, but it costs money."

"Money we have," Zorn snapped, and the women started whispering.

"Why the whispering?"  the body on the bed cried weakly.

"Whatever it is, I can take it."

"It's a hospice," the woman said harshly.

"Where they take people to die."

"I'm ready to go," the wasted young man said with no touch of bravado.
He was nearing the end and knew it.

"Let's get on with it."

When Nora nodded, Zorn lifted the man in his arms, and the woman
running the place grabbed the bedsheets, which she was obviously afraid
Nora might steal.  Zorn's labor down the stairs was too easy:

This man weighs practically nothing!  How could he have been a
roughhouse basketball player of well over two hundred pounds?  Studying
the young athlete's face he clearly saw a look of unimpaired
exceptional intelligence, and from that moment he accepted
responsibility for Jaqmeel's existence as long as the frail body could
stay alive.

As they loaded him into Nora's car, Zorn noticed that a curious looking
couple-a dumpy woman about five feet tall, and a scarecrow of a man a
foot taller-stood across the dirt-filled road photographing everything
happening at the hovel.  Returning to the landlady, he asked: "Who are
they?"  and she said with obvious bitterness: The morals police.  They
photograph everyone who enters or leaves my house."

"Why?"

They want to be sure that anyone inside dies in the proper way.

None of that Kevorkian stuff like out in Michigan.  Helping deadenders
to commit suicide."  Placing her right thumb to her nose, she threw
them an indecent gesture before slamming the door.

The hospice to which they drove, Angel of Mercy, occupied a respectable
three-story house in a reasonably decent part of Tampa, and its manager
was no frowsy bel dame in a man's sweater.  Mrs.  Angelotti was a
middle-aged Italian woman who with her husband, Tommaso, operated one
of the few havens for people with AIDS in this city, where the disease
was not yet rampant.  They all stood on the porch while Nora explained
that they were rescuing her nephew from a situation so abominable that
no stricken man should end his days there, and they were sympathetic
when Nora said: "I didn't want him to come to you, where he's supposed
to die.  It doesn't seem right."

"It isn't right!"  Mrs.  Angelotti said.

"But this is how it is."

"Can you direct us to any other place where he'd have a chance of
getting round-the-clock care?"  Dr.  Zorn asked.

"We have no such places.  Be glad you found us.  I give these men
loving care.  In their dying breath they thank us, all of them, rich or
poor, because we seem to be the only ones who give a damn."

"Can he get a doctor's care with you?"

"Most doctors don't like to come here.  What's the profit to them?

And I don't mean money.  Some of them are generous about that.  But if
they come here they run the risk of contracting AIDS, and besides, they
have no real chance of curing the young men anyway.  So it's a no-win
proposition.  It's the goodness of my husband that makes this place
possible.  One day a couple of years ago, he got real mad and said:

"We can't let them die like dogs."  You should see some of the places
these men have to go for their last days."

"We saw one of them."  Zorn said.  That's why we're here."  He had not
yet entered the hospice, but now, forced to accept the fact that there
was no alternative, he wanted to satisfy himself that the Angel of
Mercy was a proper refuge: "Could we please see your place?  Then we
can decide."  Mrs.  Angelotti looked at him and shook her head as if
she could not believe his innocence: "Doctor, not many couples are
brave enough to run a hospice, so it's leave him here or lug him back
to some foul hole in the wall.  You haven't a lot of options, you
know."

Acknowledging his naivete, Andy smiled: "OK.  But please let us look
around anyway."  They entered one of the institutions that had grown up
in response to the AIDS crisis.  It was clean.  It had a communal
dining room with flowers.  It had a reading area, with a corner for
card games, and other indications of responsible management, but the
young men they saw there were so cadaverous that any visitor did not
have to be told that the place was a refuge for those who had been
rejected by society, their friends and their families and were waiting
to die.

While still on the ground floor, they met Mr.  Angelotti in the kitchen
preparing lunch, and as they approached he explained: "I was a cook in
the navy.  It comes natural; my father was a top-flight short-order
cook at an all-night restaurant on the bay."  He told them that he
conceived the idea of turning his house into a hospice when he read
that young men with AIDS were being turned away from hospitals and
rooming houses, so, after consulting with a Dr.  Leitonen, for whom he
seemed to have great regard-'a doctor with a heart'-he and his wife
satisfied themselves that they would not contract the dread disease
solely by touch, and he quietly let it be known through Dr.  Leitonen
that he and his wife would accept AIDS patients in their final stages
of decline.

"We've cared for more than forty," he said, 'and only one has gone away
alive.  When his parents wouldn't have nothing to do with him he came
here to die, but an uncle heard about it and came here to take him into
his home-the uncle's, I mean.  He died there."

"All your patients died?"  Zorn asked, and Mr.  Angelotti said: "That's
what it is.  The disease where you always die.  Everyone you'll see
here is on his way to death, fast express.  Sometimes Rosa cries all
night, when two or three she's come to love die all at once."

"Who pays for this?"  Zorn asked.

"What they call a consortium of churches, Catholic, Jewish, Baptist,
you name it, they give us funds for food, water and electricity."  So
the old woman at the hellhole had misinformed Zorn.  But he could
understand why she had assumed that a place like this would be
expensive.

Mr.  Angelotti continued: The house we give.  But they also pay for two
part-time nurses who help us."

"You get no salary?"

"No.  We have savings.  Rosa never wasted money."

"If we decide to leave our young man with you, we'd pay."

"Some relatives do, when they find out where their boy is.  And we're
grateful."

When they went upstairs they forgot the almost cheerful atmosphere of
the reception area below, for now they saw how once-big rooms had been
partitioned to make two or even three very small cubicles, each with
its metal cot with wire springs, a thin mattress, one wafer-thin
blanket and a beat-up pillow that invariably looked as if the occupant
of the cot had wrestled with it in his sleeplessness.  And on the cots
in some of these cubicles, in various stages of exhaustion, men so
withered and enfeebled that they seemed already dead.  Certainly they
did not react to Zorn's presence, for they knew that death was near and
that conversation or other participation in social intercourse was
meaningless.

In two of the cubicles the dying men were attended by professional
nurses; they were massaging atrophied muscles or bathing hideous
bedsores.  But even those men who received what little assistance was
available in their final days seemed not to be aware that they were
being helped.  This was a place where death waited outside every door,
and little that was done on the frail cots delayed his entrance.

The sight of the cramped cubicles with their doomed occupants affected
Zorn so profoundly that he cried: "Is this the best you can do for men
who are dying?"  Mrs.  Angelotti said quietly: "It's so much better
than what we found when we started," and Zorn apologized: "I'm sorry I
said that.  Mrs.  Angelotti, you really are an angel of mercy.  But if
we bring Jaqmeel here, could he have a bigger room?  We'd pay
double."

"It could probably be arranged.  But you understand, while he's still
able to move about he'd spend most of his time with the others
downstairs.  And when that is no longer possible, one of the cubicles
would be big enough."  She touched his arm: "You see, Doctor, men like
this never have visitors.  No need for extra chairs."

"We'll go down and fetch him," Zorn said, and with the help of Mr.

Angelotti they carried Jaqmeel up to the second floor, where the two
nurses took over.  After examining him they assured Zorn and Nora
quietly: "He's not in his last stages.  Some good food, exercise,
meeting with the others will help.  And when it's time he can die with
dignity."

As Nora and Zorn departed, Jaqmeel said in a very weak voice: "I know
where I am, and I'm glad to be here.  It doesn't smell."

In the room downstairs that served as a kind of office, Zorn gave the
Angelottis a hundred and fifty dollars for Jaqmeel's first week and
embraced each of them in turn: "You are truly Good Samaritans," then he
cleared his throat and said: "Now, where can I find a doctor who will
care for him?"

"Most doctors won't come near this place," Mrs.  Angelotti said, 'but
there is the one we mentioned to you, a living saint, who does come
here and performs wonders for our men."

"Where can I find this doctor you mentioned?"  Zorn asked, and she
wrote out an address: "Not far from here."  When Zorn telephoned the
doctor's office, he found he was not in, but would be later that
afternoon.  He asked for an appointment, and in this roundabout way
Andy Zorn was projected into the heart of the AIDS crisis.

The euphoria that had marked the tertulia's aviation project vanished
when a truck delivered a large package to the Palms addressed to Haul
Jimenez, who had assumed responsibility for ordering the engine for
their airplane.  It had been sent down from the Lycoming people in
Pennsylvania and was professionally packed with sachets of a silica gel
to absorb moisture that would rust the delicate parts of the engine.

When the package was solemnly opened in the presence of the five who
were building the plane and the engine reflected sunlight from its
polished surfaces, the men did not, as one might have expected, react
joyfully and revel in their new acquisition.

Instead they looked at it soberly, for they realized that its arrival
had altered everything.  They were no longer playing at little boys'
games.

Now, in the real world and within a measurable time, they would be
forced to bolt that engine into their homemade contraption, rev it
over, apply the gas and fly the bundle into the air, with the channel
to the west and the Gulf of Mexico beyond.

"Ideal engine for a small plane like ours," President Armitage said
professionally.

"Amazing how light they can make it and still turn out the power."

Lewandowski was satisfied with the specifications provided in the
handbook: "It can produce twice the power we'll ever need," and he
visually checked the various components, giving it as his practiced
opinion that it was a superior engine.

Senator Raborn said it was durable: "That little monster can take a lot
of punishment.  Gives you a feeling of confidence.  Worth the money,
too."

That night, when the tertulia assembled in their corner, the
conversation did not focus on some arcane topic.  Ambassador St.

Pres cut right to the subject that was on all their minds, approaching
it in his customary urbane way: "I've been wondering if any of us have
been having second thoughts about our grand adventure."

"Heavens, no!"  Armitage said quickly, but the more cautious Jimenez
asked: "What did you mean, Richard-lack of nerve?"

"No, no!  Just that we represent, whether we like it or not, the entire
establishment of the Palms, and a failure on our part, a disaster if
you will, might have regrettable consequences.  I was simply wondering
if we were prepared to take that risk, not to ourselves but to our
larger community."

Raborn said bluntly: "Richard, if you're hesitant about taking the
first flight, you should know that I had my license reactivated two
weeks ago.  Just in case something like this came up.  The doctor said
I had the heart functions of a man of fifty and the reaction times of a
thirty-year-old-and that was without wearing my glasses.  So I'm the
backup pilot and I say we go."

So did the others, but without the bravado they had shown at the
beginning when actual flight was still far in the future.  When
Lewandowski came over to join the table he brought with him a touch of
even more reality.  As a cautious scientist he said: "We should
test-run the engine right away.  Bolt it down to heavy boards, pile it
up, fill her partway with gas, and check how she performs."

"We won't be fitting it in the plane for weeks," Armitage pointed out,
but the old research expert said: "More's the reason to check it now.

We can send back for another if things should go wrong."  He made plans
with Raborn to run the tests in the morning.  The others agreed that it
was a prudent move.

As they were finishing the meal the ambassador said, slowly and
gravely: "Gentlemen .. ."  He had never used that opening before with
his tertulia.

"On the eve of any major battle action-and our airplane project is just
such a major undertaking-sensible soldiers and sailors have somber
thoughts.  I remember in World War Two on the eve of one of the great
naval battles in Leyte Gulf, I was serving as junior officer of the
bridge with Admiral Olendorf and he had cleverly deduced where a major
part of the Japanese fleet was at midnight and where they would be at
dawn, and he believed he had a chance to execute one of the supreme
maneuvers of naval strategy, to Cross the Enemy's T."

"What does that mean?"  Jimenez asked.

The American warships calculate when the Japanese ships will be coming
out of the strait.  The enemy is the long downward leg of the T, we're
the crossbar at the top.  Do you see what happens?  As each enemy ship
comes out of the leg, he faces our entire line of heavy warships
cutting across his path.  He can fire his big guns at one of our ships,
whichever he elects, but we have nine massive ships that can bring
their fire on him.  And when he sinks, as he must under that
bombardment, the next Japanese ship staggers forward, fires its guns at
one of our ships, and again, nine of ours blow him out of the water.

"Now, the possibility of accomplishing this was so exciting that those
of us with whom it was going to be attempted could not sleep the five
hours before the "battle.  I was worried sick, wondering what would
happen if some super sharp Japanese admiral were to cross our T and
blow us out of the water, one by one.

"I asked an older officer what that would mean and he said: "It will
mean our Old Man guessed wrong."  ' "What happened?"  Armitage asked,
and the ambassador said: "It's in the history books.  We crossed their
T just as Olendorf had planned, destroyed that part of the Japanese
fleet and allowed our small carriers in another part of the gulf to
turn back the main arm of the enemy fleet, while Halsey sent his planes
forward to sink their big carriers to the north."  He paused, then
said: "Naval historians believe our battle to the south was the last
time in naval history that battleships will ever fire their big guns at
enemy ships.  Planes will be sent forward to do the killing.  And there
will never again be a Crossing of the T."

Raul Jimenez's story had to do with a different kind of war: "When I
used my paper to wage war against the Medellin cartel, which was
assassinating any judges who opposed their criminal drug activities,
the boss criminals occupied another newspaper and threatened me with
the headline EDITOR JIMENEZ CONDEMNED TO DEATH.  I brazened it out;
they stormed my newspaper and executed my assistant editor, who looked
a lot like me.  That's when my wife and I sought refuge in the United
States."

Senator Raborn had been a marine lieutenant in the battle for New
Guinea and had led a patrol-in-strength along the trail from Port
Moresby over the mountains to capture the port the Japanese held at
Lae: "Before we could think of attacking Lae, we had to subdue enemy
strongholds at Aitape and Wau.  Very tough battles, so we were
exhausted when we finally came down the mountains to face Lae itself.

I was given orders to lead the assault from the west, and as we moved
into position I thought: What a hell of a note!  To fight my way clear
across this damned island only to get it in the neck at Lae!  So at the
big push, when we stormed the Japanese position, I held back, planning
to forge ahead like gang busters in the second wave.  A second
lieutenant saw what I was doing, threw me a look of scorn and contempt
and led the marines in.  He got it full in the face and I got a medal
for my gallant leadership in the conquest of Lae."  He blew his nose
and added what was clearly the truth: "But at other actions in Okinawa
I made amends, and the medals I earned are for real.  The one from Lae
I never wear."

President Armitage had been an army second lieutenant at the Anzio
landing, becoming a captain by field promotions on the march up the
boot of Italy to Rome: "I was terrified all the way, at every new
battle against the Germans, but when we entered Rome and the girls
wanted to kiss us as heroes, I moved to the head of the line."

These men's behavior under fire and their brilliant careers in
peacetime had earned them the right to pontificate in their years of
retirement as members of Raid's tertulia, and the Colombian, perhaps,
deserved the greatest accolades of all, for he had risked his life many
times over to protect the honor of his country, and had left his
homeland only when it became hopelessly corrupt.

The waiters appeared with the dessert and midnight approached, but
still the veterans talked of battles lost and won.  St.  Pres had the
last word: Then it's agreed that we finish the plane, install the
engine and fly it?"  There was no dissent.

In addition to Nurse Nora, there was another woman in Gateways who
followed the progress of young Betsy Cawthorn and her romantic
attachment to Dr.  Zorn with more than casual attention.  Reverend
Quade had, through her professional career, observed so many love
affairs, including three at the Palms that had ended in weddings, that
she had almost been able to chart Betsy's growing interest in her
doctor.  The night after Betsy had revealed her emotions by embracing
Zorn in public at the end of her first walk, she had said to herself:
Poor child, she's been desperately in love with him since the moment
she arrived, and probably before.  Thank the Lord he's not married, or
this could prove a sorry mess.

Because she wanted to talk with Betsy, she waited till she saw her
eating alone one noon when the dining room was nearly empty.  The
Duchess, of course, was lunching in solitary splendor at table fifteen,
and a few couples who did not enjoy preparing noontime meals themselves
were at their tables.

"May I join you?"  Reverend Quade asked and Betsy said eagerly:

"Oh, I would like that.  I've been wanting to get together so we could
talk."

"Now's the time," the Reverend said as she ordered a light salad.

"I've wanted to talk because you're a minister.  Your job is to listen
to people who are muddled up."

"If I've seen a young woman recently who's anything but muddled, it's
you, Betsy.  You're making a remarkable recovery, from what I've
observed and what they tell me."

"What did people tell you?"

"It'll be better if I state it plainly, right at the start.  They said
that after your terrible accident you had fallen into a deep
depression, refused the normal procedures to be followed after any
amputation,

and since you'd had a double you were entitled to a king-size mourning
period.  But you carried it too far.  You overdid the self-pity."

"Whoever your mysterious they were, they certainly diagnosed me
correctly, but they stopped short, maybe because they didn't know or
didn't want to know."

"Should I know?"

"Yes, because I trust you.  I refused to deal with psychiatrists. Daddy
wanted to bring in three or four different ones, good doctors, I'm
sure, but I was scared of them."

"And you think I'm safer than them?"

"Yes.  You're a trained minister, you have a special compassion and
you're a woman, too."

"So what's the problem?  What did they not know that you now want to
discuss with me?"

Betsy paused for some time, then said very tentatively: "I came closer
to suicide than any of them realized.  Very near."

"You thought your life was over and were willing to end it?"

"I feared that my chances for a normal life of any kind were over.  No
more tennis, no more hiking in the woods, no more fun of any kind.  I
was terrified."

"And now you realize that within a couple of weeks you and I can be
walking in the savanna out there, if we choose a reasonably level
stretch."

"Yes, things have changed, and I'm elated, as you've probably
noticed."

"Yes, I've watched life and color come back into those cheeks."  She
reached out and took Betsy's hand: "It's so wonderful to see spring
after a long winter."

"And now we come to what's tormenting me, but in a far less urgent way
than the amputations."

"And what is this slow burn?  Sometimes it's more fatal than the sudden
conflagration that people can see and extinguish."

"If I fell into a deep depression once, can it happen again?  I mean,
these weeks have been great.  Bedford Yancey is so terrific-he has the
energy of six people.  Nora has been wonderful.  And that orthopedic
guy is a genius.  I tell him: "This doesn't feel quite right," and he
twists a few screws on that incredible English leg and it feels like a
real leg again."

Reverend Quade, aware that Betsy was being evasive, asked: "And what of
Dr.  Zorn?  Hasn't he made a contribution?"

Betsy blushed, but she was obviously eager to discover what Mrs.

Quade thought of Andy, so she confessed: "I get such mixed signals.

This morning in Rehab he was all attention, very supportive.  But
tomorrow he'll probably ignore me.  Days pass and I don't even see
him."

"I remember how it used to be with me.  The same.  Men can be very
difficult."

There was a pause, and then Reverend Quade said: "To get back to what
you were saying about depression, are you afraid of a letdown after all
the positive things that have happened?"

"No, it's not that.  It's that I wonder how I would react to something
big, like my father's death.  I adore that man, he's everything to me.
Or if I never found a man who would want to be my husband."

"You're referring to a specific man, perhaps?"

The question came so suddenly that Betsy blushed and looked away,
unable to respond.  Very quietly Reverend Quade said: "We older women
know you're desperately in love with him.  We know the signals.  Most
of us have been there..  .."

"Is it so obvious?"

"Betsy!  You shout your message, and it's a wonderful one.  Precisely
the one you should be considering.  When he comes into a room your eyes
are fixed on him.  When his name is mentioned at the bridge table, you
blush.  Right now your face is nearly crimson.  We all know, and we
think it's wonderful."

"Am I so transparent?"

"Betsy, my dear child.  He's worse than you are.  Why do you suppose he
finds excuses for coming to see you in rehab?  Why was he there that
day you took your first walk alone?  They told me about it.  He
insisted on being there."

"Yes.  But after I kissed him he pushed me away.  He doesn't want me.

After all'-her voice dropped to a whisper-"I have no legs."  Uttering
the terrible words was so shattering that she lowered her head and
wept.

Reverend Quade waited for Betsy to regain her composure, then said
cheerily: "I'd like to tell you about what happened to me when I was
your age.  Our family was in China, in a village not far from

Shanghai, and whenever a new young missionary man came to town the
entire female population-Americans, British, Chinese-could discuss only
one topic: "Which lucky young woman is going to land this one?"

When one especially wonderful young man arrived, a Presbyterian
missionary straight out of Princeton, a Presbyterian college, I was the
one who caught him."

That must have been an exciting time even though it must seem so long
ago."

"It seems like yesterday.  Three other young women might have got him,
including a fine English girl who is still my friend.  But I used all
my tricks, and in the years when I was struggling along as one of the
first women ministers, Laurence was a pillar of strength.  Once he
almost had a fistfight with a high official of the church."  She
laughed, then added: "A good man is truly worth having, no matter the
cost, and from what I see and hear, Andy Zorn is a good man.  Not a
world beater-Laurence wasn't either-but he was there when I had a tough
time becoming a minister and I would expect Zorn would be just as
supportive."

A smile crossed her face as she recalled those wondrous days of first
love, and after a pause she continued: "And how do you suppose it was
that I summoned the courage to go after Laurence?  Because I had
watched what happened to women in China who found no husband.

They lived in the households of their more fortunate sisters who had
one and became amahs.  They spent their days cooking in the kitchen and
tending their sisters' babies, and each year growing older and
lonelier, never having a life and love they could call their own."

She paused, for she feared that what she had to say next would sound
too calculating, but then she plunged ahead: "One day it struck me with
full force that a husband is worth having, and it was worth making
every effort to win a good one.  So when Laurence appeared I set out to
win him with an abandon I never knew I had.  You can do the same."

As she said this she happened to look across the room at the Duchess,
who was finishing her lunch in the solitude she preferred.  The time
had come to ignore her aloofness, and Mrs.  Quade rose and crossed the
room to table fifteen: "Mrs.  Elmore, I have this troubled young woman
lunching with me, and I think she would be grateful if you could give
her a few words of counsel.  May I please bring her over?"

"I prefer to dine alone."

"I'm well aware of that.  But you're finished eating and this child
needs advice."

"Bring her over."

When the three were together, Reverend Quade said: "Betsy here has been
sadly crippled, as you know, but she's making a strong recovery, and
the question has come up: Can a young woman with such a serious
handicap expect to marry?"

The Duchess pondered this, then said reflectively: "I attended a fine
girls' school in England, as I'm sure I must have told you before.  We
had a math teacher with a horrid purplish birthmark filling the left
side of her face.  I can see it now.  Otherwise she was a handsome
woman who lived what appeared to be a rather satisfying life, but no
men came near her.  Then, in her thirties, a specialist came from
Vienna and he bleached that spot clean off her face.  Gone.  And within
six months she was married to our classics teacher."  She turned to
Betsy and said: "So your problem seems to parallel Miss Blanton's.  Now
with your new legs, there's nothing wrong with you."  She then turned
her back on Betsy and spoke to the minister: "And I would say you're
wasting your time worrying about this young woman.  I see her and the
doctor leaving with a group to go to the cinema in town, and when they
come back and he unloads her walker, it's obvious to me how he feels
about her."  When Betsy blushed, the Duchess reached across the table,
pressed her hand and said: "Go for it, lassie, while you still have
your looks, and exceptional ones they are, too."

Back at their own table, Reverend Quade said: "We got a little more
there than I bargained for, but I believe that between what I counseled
and her down-to-earth advice you have whatever guidance you need."

"Yes.  Philosophically.  But what should I actually do?"

"I've always preached the Christian response.  We put our faith in the
God of the Old Testament, listen to the teaching of His Son in the New,
and mix in a large dollop of common sense."

Leaving for his scheduled appointment, Andy had told Nora: Take charge.
I'm off to see this Dr.  Leitonen about your nephew," and he drove to
an office building occupied by a wide assortment of medical experts,
including dentists and psychiatrists.  Dr.  Leitonen shared his office
on the third floor with a Dr.  Marshall, whom Zorn did not see.

Their waiting room had a touch of shabbiness, as if their practice was
not going well, but it did have five back copies of The Economist-one
of the better magazines in the world, in Zorn's opinion.

When he asked the nurse at the reception desk what her two doctors
specialized in, she said: "Dr.  Marshall's no longer with us.  He could
not approve of Dr.  Leitonen's concentration on AIDS.  Quite often
those cases can't pay, you know."

After a short wait, he was ushered into the presence of a most
unusual-looking man.  Short, squarish, with big body muscles, a thick
neck and big hands, Dr.  Leitonen had a puckish face with dancing eyes
and an infectious smile and, although he could hardly have been out of
his forties, a head of snow-white hair.  Zorn assumed that his name was
Swedish and that he had the startling hair so common in that northern
nation.

Since most patients who came to see him were involved in life-and death
problems, Dr.  Leitonen was in the habit of pressing directly to
whatever problem was at hand: "So Mrs.  Angelotti wants you and me to
give her some help in the case of that remarkable basketball player."
He consulted notes: "Yes, Jaqmeel Reed.  Where do they dream up those
names?  I saw him several times when he played here in Tampa.  My
friends who know more about the game than I do think that he could have
become a professional.  And now it ends in AIDS.  I saw him the
afternoon after you left him at the hospice.  What a hell of a fourth
quarter, but there's much I can do to ease his passage.  To give him a
decent life-so long as he can hang on."

"It's what it's come down to, isn't it, hanging on?"

Dr.  Leitonen stared at the ceiling, then said: "Dr.  Zorn, this nation
the world-is faced with a plague.  We've only just now identified the
causes, and we may be decades away from a cure.  By accident I've made
myself the repository of almost all that we know at present, and I can
tell you it isn't much."

"What got you involved?"  Zorn asked and Leitonen frowned: "Several
years ago I was taken almost forcibly-by my nephew-to see a sick friend
of his.  The kid was in such terrible shape that I said: "You ought to
be in a hospital," and he told me: "Hospitals won't take people like
me.

I have AIDS."  I was repelled, terrified I might catch it from him, and
then I was angry that something like this could come along that our
medical profession would shy away from.  That day I started on the road
to becoming an AIDS specialist."

"I hear that your partner bailed out."

"He did and I don't blame him.  Because our office became crowded with
frightened friends and relatives-and by young men in pitiful shape.  It
was not a pleasant place to be.  But the deeper I dug into the mystery,
the more dedicated I became to helping the victims, to finding
solutions."

Now, studying Leitonen carefully, Zorn thought that had this dedicated
man not concentrated his efforts on AIDS he would probably have been
enjoying a lucrative practice, for he had so much energy, such an
engaging personality and, obviously, a quick, inquiring mind.

"As you know, in AIDS everything starts with the immune system.

We carry a million germs in our bodies, some of them deadly, but we
have built-in systems of checks and balances that fight back the little
devils.  We've had the germs every day for years but our defenses keep
them at bay.  But the immune system can get tired, and then it doesn't
fight back.  As you know, when we're extremely tired, we're apt to
catch a cold, then we rest, the system rests, and when it's stronger it
knocks out the cold.

"But in AIDS the immune system isn't merely tired.  It's knocked clean
to hell, and the most trivial accident, the most insignificant sniffle
becomes so powerful that it can kill you.  What it will be in Mr.
Reed's case that carries him off we can't anticipate, and the hell of
it is, we can't even approximate how long it will be before it happens.
I have patients who linger on for more than a year, dying a little
every day, terrified, watching the others die quickly.  Either way,
it's a terrible end to a life, but we have no answer to the problem."

He concluded gloomily: "So Mr.  Reed knows he's dying, and may even
want to get it over with, but he has no assurance of how or when or in
how much final pain.  One of my patients, a fellow named Saul-I liked
him tremendously-had an ingrown toenail that got infected in spite of
all I could do.  I had to amputate his leg, which allowed him to live
three months longer.  Had to clean the stump of the leg three times a
week-his immune system provided none of the curative power that would
normally enable a stump like that to harden in three weeks."  Grimly he
said: "It was one hell of a way to die-an ingrown toenail .. ."

As an afterthought Leitonen added a macabre anecdote: "This Saul I
spoke of had a friend named Christopher, who faithfully tended him
until he died.  Not surprisingly, Chris began to fear he might have
contracted AIDS from his contact with Saul.  So I ran a series of
tests, and when I showed the data to Chris he sighed with relief:
"Thank God it's only cancer.  For that we have cures."  And there you
have it, Zorn, AIDS is what makes cancer seem benign."

As he hurried off to make his rounds, the feisty little doctor
promised: "I'll visit Reed again at eleven tomorrow.  I'd like to have
you there so you can make your own judgment as to how we should treat
this brave young man."  As he reached the door he turned to say: "Not
many doctors, when they make their rounds, know that every patient they
see will soon be dead.  Other doctors sometimes cure their patients.  I
never do."

The next day Zorn hurried to the Angelottis' where Dr.  Leitonen had
told him he would be waiting but the busy doctor had phoned to say he'd
be a few minutes late.  As Mrs.  Angelotti delivered the message Zorn
caught a fleeting glimpse of a man furtively descending the stairway
behind her, a tall man dressed in black and wearing a Borsalino with
the brim pulled down to mask his face and eyes.  Zorn thought he looked
like Zorro in a Grade B movie and wanted to ask Mrs.  Angelotti who the
man was, but his shifty manner indicated that he had hoped to slip out
before anyone could question him, so Zorn assumed that he was simply a
shady intruder.

While awaiting Dr.  Leitonen, Zorn sat in the reception area, where two
emaciated men were playing chess without speaking, as if they had to
conserve all their strength for the demands of the game.  They were so
thin and their faces so distorted that it was impossible to guess their
ages; they could have been in their forties or, perhaps more likely, in
their twenties.  They moved their hands with extraordinary slowness, as
if the task of getting an arm in motion was so difficult that one had
to allow it to take its own leisurely course.  Another peculiarity was
that the two men moved no parts of their bodies below the shoulders:

trunk, legs, feet remained immobile, and even their heads, once set
carefully in a certain position, remained stationary; they did not turn
even slightly to notice his intrusion into their space.  But despite
their physical immobility he had the strong impression that they played
their game at a high level of intellectual intensity; mercifully, their
brains were not as depleted as their bodies.  For Andy the scene was a
caricature of AIDS: two ghastly figures playing chess with neither
caring who wins because it doesn't matter.

When Leitonen arrived he apologized for his tardiness: "More patients
every day.  We need a lot of doctors like me, but we don't have them."
He corrected himself: "Some of the older doctors are terrified of AIDS.
Will have nothing to do with it, but more of the younger men
understand, and some of them volunteer to help.  And then something
like Dr.  Weatherby's case comes along, and we're back to square
one."

"What happened to him?"  Andy asked, and Leitonen explained:

"While treating a patient, he noticed a pustule on the man's arm and
told him: "That could prove fatal if it's not treated," but when he
lanced it he nicked himself, and he became the fatality."

When they ascended to the second floor, Zorn observed that Leitonen was
so busy he could not waste time on niceties, regardless of the severity
of the patient's illness.  At first, he seemed unusually brusque as he
plunged directly to the purpose of his visit and asked: "Mr.

Reed, do you really want to know everything I've found out about your
condition?  No punches pulled?"

"Yes."

Bluntly Leitonen rattled off his findings: "Blood tests show red count
way down-the left lung quite filled.  Doesn't look good-everything is
in about what we would expect at your stage."

"So?"

"You fall into the basic patterns of this disease."

"What stage am I in?"

Firmly, but with gentleness, Leitonen laid out the facts: The rate at
which your weight has declined parallels the other cases, no worse, no
better.  Your susceptibility to minor afflictions, about the same. Like
the others, you seem particularly susceptible to some threatening

weakness.  For others it may be the liver, may be bleeding ulcers; for
you, pulmonary weakness-that hacking cough.  So you must be considered
quite normal."

"On the big roller coaster straight to hell?"

Andy now witnessed a prime example of what his medical school
instructors call 'the bedside manner," because Leitonen became
infinitely gentle: "Mr.  Reed, I'm not a theologian.  I can't answer
some of your biggest fears, but I am a doctor with broad experience and
I sincerely want to help you.  As I told you yesterday, you could have
many months before your body has to give up-or, on the other hand, you
could go suddenly if that cough worsens."

"I see no purpose in hanging on.  I'd like to get this over with."

Placing his gloved hand on the sick man's arm, Leitonen said softly:

"Mr.  Reed, I understand how difficult this is for you..  .."

"Does everyone have to put on gloves to touch me?  Am I something set
apart, behind a wall of rubber gloves?"

"Mr.  Reed," Leitonen said, 'a doctor friend of mine didn't wear his
gloves, got infected and died.  Doctors are needed-you should know-'
The room was silent, then Reed said: "I apologize," and Leitonen
replied: "I apologize to you for speaking so bluntly, but my obligation
is to keep you alive.  I'm not only sworn to do so, I'm legally bound.
But I'm also driven by the absolute belief that one of these days
there'll be a breakthrough.  Our geniuses in the laboratories are going
to lick this plague, and you could be one of the first to profit from
what they discover.  I live on hope and so should you."

"Then you won't help me to end my misery?"

"I will not.  But I will ease your passage.  There are ways, you
know."

"Please don't use them on me, because I lost hope months ago."  After a
horrible fit of coughing he turned suddenly to Zorn.

"When you moved me out of that pigsty to this good room, you didn't
change my view of myself.  I've lost the battle.  I've thrown away my
life, and I want no aid, no sympathy.  I just want to die."

Dr.  Leitonen sat on the bed as if he were a visiting friend:' Jaqmeel,
I respect you and I understand what you're saying.  But you must
remember that in this brutal game, we're on opposite sides: you try to
die, and I try to keep you alive."

At three-thirty one hot August night Marjorie Duggan awoke in her
private room in Assisted Living and, feeling a great urge to travel,
dressed without assistance in a flimsy dressing gown thrown over her
even more flimsy nightdress.  Making her way to the door of her room,
she suddenly stopped, looked down at her feet and saw that they were
bare.  Reason could not have warned her that what she planned was
impossible if she went barefoot, for she had long since lost all
capacity to reason, nor could she any longer plan ahead for anything.
But apparently some instinct warned her to put on shoes, which she
tried to do.

She was incapable of sorting out the footwear at the edge of her bed,
for she could not differentiate between a walking shoe, a dress shoe
and a bedroom slipper.  By bad luck she settled on a pair of slippers
so fragile that normally her nurse would not have allowed her to go on
the porch in them.  Thrusting her right foot into the left slipper and
vice versa, she sensed immediately that something was wrong, so she
kicked off the slippers, shuffled them and again put the wrong one on
the wrong foot.  Again she knew that something was not right, so once
more she tried, and this time, when she put them on, she got it right,
and with a vague sense of accomplishment she set forth on what would
prove to be a memorable adventure.

She had by accident stumbled upon that time of night when nurses were
apt to be asleep and watchmen drowsy, so, by sheer accident she fell
between the cracks, as it were, leaving her room without detection and
making her way to the elevator, which, again through some instinct, she
realized she could not operate without the assistance of another
person.  Quietly pushing open the door to the stairway that descended
parallel to the elevator, she carefully grasped the railing with her
left hand and moved down the stairs.

At the front desk there was no one awake to notice her, and the
watchman was enjoying a cigarette out on a porch, since smoking was
forbidden in the health center.  She thus found herself safely out in
the oval where none of the parked cars contained occupants who would
have seen her.  Exiting through the big gates, she came to the junction
from which the main road into the Palms reached straight ahead, with
the narrow lane reaching off to the south.  Intuitively she guessed
that she had a better chance of walking unnoticed if she took the lane,
and this she did, walking through the balmy night air with a strong
sense of determination both to remain undetected and to distance
herself from Assisted Living.  These two compulsions resulted in a
rather rapid gait, and had some stranger watched her stride he might
well have concluded that she was some health nut out for a predawn walk
and determined to make it a vigorous one.  Had he looked more closely,
however, he would have discarded that hypothesis, for he would have
seen that she was not only dressed improperly but also that she was
almost grotesquely underweight: five feet six inches tall, one hundred
pounds when properly clothed.

When she neared the point where the lane merged into the mall she
seemed to know that if she went any farther she would find herself on
the main street, Broadway, and this she did not want.  Instead, she
left the lane, turned south and entered upon that warren of little
trails that crisscrossed the savanna, finding what she had sought from
the moment she climbed out of bed, the freedom of the open air, escape
from nurses and bells, the joy of striding along as the sun began to
display its power in the east.  As she made her way among the bushes,
the scrub trees and the upward reaching palms, bits and pieces of "Mira
o Norma," the duet from the opera that she had cherished so long ago,
came flitting into her confused brain, and she smiled as she
experienced a sensuous joy.

Her uninterrupted walk carried her well to the southwest toward the
nesting place of the blue herons, and as she came humming past them
they rose, flew a short distance from their nests, then winged back
when they realized that the figure in the flowing gray and pink garment
meant them no harm.  A few hundred yards farther on she came to where
the snowy egrets spent the night, but she was sufficiently far from
them that they did not fly away, and for some moments she and the
standing birds formed a handsome group, staring at one another, her
clothing much like their downy feathers.  Then the egrets flew off to
do their early morning fishing.

Some distance farther along, but still in a southwest direction, she
came to the Emerald Pool, shimmeringly beautiful in the growing morning
light.  Unaware of the danger she was placing herself in, she stepped
in her bedroom slippers quite close to where the rattlesnake was
hiding, nursing the wounds he had suffered during his ill-fated foray
into the heron rookery.  Seeing the cloudlike figure coming at him, he
drew himself into a tight coil so that he could strike out if it moved
any closer.  Then, to give ample warning, he activated his rattle,
which caused Marjorie to stop, listen admiringly and ask aloud: "What
bird could that be?"  Then, without waiting for an answer, for she had
forgotten her question, she moved on, leaving Rattler content that he
had not had to waste his energy by striking at a target that he knew he
could not eat because of its size.

What impelled Mrs.  Duggan on this perilous safari?  A doctor might
come up with this analysis: The patient knows in some primordial way
that things are not as they should be, and thinks that it is somehow
the fault of the nurses and the caretakers.  The determination to walk,
regardless of the difficulties, becomes overwhelming, and off he or she
goes.  With powerful men it is sometimes almost impossible to prevent
their breaking away, for they are driven in ways that you and I cannot
comprehend."

Majorie Duggan's trek from the lane to the Emerald Pool and her close
encounter with the rattlesnake had brought her deep into the savanna,
but even so, she could have made her way back to the Palms with
relative ease had she found the rough path that led to the snowy egret
and the blue heron, but she was not capable of finding the path or
recognizing it if she did find it.  Some instinct told her to head back
toward the rising sun, and this put her on a general easterly path,
which she pursued with vigor.

But now she was in the uncharted savanna, a woman skimpily dressed and
in footwear that could not withstand rugged terrain.  Nor did she have
an abundance of physical energy.  But driven by whatever force had
taken her from her bed and away from the security of Assisted Living,
she plunged into the thickets the bulldozers had not yet cleared as if
dressed in safari gear and guided by a compass.  In the first few
minutes she had to bend under the branches of a thorny bush which tore
at her dressing gown, leaving most of its lower half in tatters.
Feeling the thorns clutch at her gown without scratching her, she
tugged at it with some force and tore it in several places before she
dragged it loose.  She plunged ahead, losing bits of her clothing as
she went.

When she was again well north of the heron rookery, those stately birds
heard the noise of her rough passage and flew over to see what was
happening.  Finding them in the air above her, she paused, looked up at
their ungraceful but delightful forms and cried: "Hello, there.  Who
are you?"  She was unable to determine that they were birds, but when
they stayed nearby as if to guide a friend, she pushed her way through
what remained of the prickly brush, singing to them as they showed her
the way.  When they finally departed, satisfied that she had no food
for them, she cried: "Good-bye!"  and pursued her way eastward.

It was now seven-thirty in the morning and she had some distance yet to
go through the veldt before she would again intersect the lane.  If,
when she reached it, she had turned left she would soon have been back
at the Palms, tattered and worn but intact.  When she saw the road
ahead, however, she was so delighted that she began to run.  She was
not aware that her clothes had been torn almost completely off her and
that she was virtually naked.  Nor did she know that both her legs were
scraped and bleeding from her bruising battles with the thorny
bushes.

All she knew was that by heading east she had reached a kind of safety,
so she ran toward the lane, kept to the east and wound up in the middle
of the mall at the intersection of Route 78 and Broadway.

Relaxing somewhat after her strenuous battle with the savanna, she
suddenly realized that she had to go to the bathroom, and when she saw
a planter-an architectural feature in which tiles were used to build a
square container in the middle of a highway in which colorful plants
can be grown-she mistook the tiles as part of a bathroom, hiked up what
was left of her shredded clothes, and relieved herself in full view of
the morning traffic.

The first official to be summoned was a tall young policeman named
Johnson, who first thought from the cries of bystanders that someone
had been hit by a car.  Hurrying up and taking one look at the
beautiful, vacant face, he behaved admirably, guessing that she might
be some patient from the Palms, and wrapped his light uniform jacket
about her shoulders.

After radioing to headquarters: "Call the Palms, they'll be looking for
her," he led her gently to a bench that fronted a store on Broadway,
and there she waited, head on his shoulder, content to see what might
happen next.  She had been away from her room for five hours, and she
had been walking constantly, much of the time through difficult
terrain, but despite her fragile condition she would still have been
prepared, and even eager, to resume walking had she been allowed.

People at the Palms who should have caught her as she left her room and
escaped into the night did not detect her absence until half after six,
an unconscionable delay, and even then neither Dr.  Zorn nor Muley
Duggan was informed.  Not until seven-ten did they learn that Marjorie
had, as the nurses said, 'gone a-walking."  But as soon as it was
generally known, search teams streamed down the roads and footpaths,
for it was understood that when an Alzheimer's patient broke loose on
his or her own, the walking spree might carry the person anywhere.  No
distance was too great, no destination too bizarre.

With Andy at the wheel of the staff car and Muley Duggan beside him,
the two set out for a rapid reconnaissance of the main roads, looking
for the runaway, but also for any unusual cluster of early morning
risers who would probably have gathered about a woman who was clearly
in trouble.  Afraid that she might have fainted in some isolated spot,
they intensified their search, calling back on the cellular phone to
Nurse Varney at the Palms: "Any news yet, Nora?"

"Nothing.  But everybody's out searching."

"Any reports from the police?"

"They've been here interrogating everyone.  No news from their
headquarters."

Shortly after nine Nora called with the news: "An Officer Johnson found
her on Route 78 and Broadway.  Legs cut by thorns apparently, and near
naked but not otherwise damaged.  He's keeping her there till we
arrive.  She's warm and has taken some hot coffee."

Overcome by the sickening report about his wife, Muley slumped forward
and, covering his face, began crying.  Andy tried to comfort him:
"She's alive, Muley.  All the rest is of no consequence."  When his car
screeched to a stop at the intersection he saw the large crowd
surrounding Marjorie, who kept her head resting on the policeman's
shoulder, happy and oblivious to the world.  Incongruously the thought
struck him: My God, she's beautiful!  and she was, with her translucent
skin, perfect features and elegant bearing.  In the morning sunlight
she was more beautiful than she had been at nineteen.

When she sensed it was Muley who was consoling her as he wrapped her in
blankets she began berating him: "You made me cut my legs, You did it.
You punched me."  In a loud voice that seemed to come not from her
frail body but from some evil, lurking spirit, she kept screaming at
him and trying to break away as he led her to Zorn's car.  This assault
was fundamental, springing from a profound disarrangement of her human
psyche.

At dusk that night it would become vastly worse.  Muley Duggan,
although aware that everyone in Gateways knew about his wife's
extraordinary behavior, was determined to maintain his established
routine in dealing with her problems, refusing to be unduly concerned
about other people's reactions.  He certainly felt no shame, and
contrary to general expectations, he had no intention of keeping her
hidden in her room.

So to everyone's amazement, at five o'clock he reported as usual to her
room on the second floor, helped the nurse dress her in a pretty skirt
and blouse, gently took her arm and took her to the elevator, where the
nurse cried: "Oh, Mr.  Duggan!  You're not taking her down to dinner?
Not tonight?"

"Especially tonight," he said as he walked with Marjorie into the
elevator.

The Duggans entered the dining room through the eastern door, and Muley
had to escort his wife past the other tables; as he did so he marched
erect, a tough Brooklyn alley fighter walking as tall as he could and
defying the assembly as if to proclaim: This is the woman I vowed to
protect in sickness and in health, for richer or poorer, until death do
us part.  And the manner in which he helped her into her seat at the
table was so tender that people throughout the Assisted Living dining
room caught a new definition of married love.

And then the storm broke.  When Marjorie was properly seated, with
Muley beginning to feed her, one spoonful at a time, her confused mind
once more identified Muley as the cause of whatever wrong that had been
inflicted on her.  In a loud, raspish voice so at odds with her angelic
appearance, she cried as she pushed him away, spilling her food across
the table: "You stole my money!  You took it away from me and spent it
on that girl.  You brought me here to get rid of me.  I'm on to your
evil ways, you swine."

Her accusations could be clearly heard throughout the small dining
area, and the more gently he tried to calm her, the more violent her
accusations against him became, until everyone in the room knew that
Marjorie was acting up again.  A black college student who waited on
their table heard the commotion and walked quietly forward until he
stood beside her.  Gently he told her: "It's all right, Mrs.  Duggan,"
and it was as if her mind cleared momentarily, for she patted his hand
and said in her sweetest voice: Thank you, Ernest.  You're the one man
in this place I can trust."

At the other occupied tables men coughed and women wiped their eyes or
looked away, and when the waiter helped her from her chair and started
walking with her toward the elevator, Muley thanked him and tried to
take over, but when Marjorie saw him approach she screamed: "No! You're
the one who put me here," and Muley had to trail behind as the waiter
took her from the dining room.

That night, even those residents who had blinkered themselves against
Alzheimer's awoke to the reality of what Alzheimer's was and how it
tore down men like Muley Duggan to the point of utter despair.

There was not much talking in the room as Marjorie Duggan and her two
attendants departed.

Later in the evening, Andy and Krenek went quietly to the suite in
Gateways that Muley Duggan now occupied by himself.  After
commiserating with him over the terrible experiences of the day, Krenek
said: "Mr.  Duggan, the staff feels, unanimously, that it would be
better if you and Mrs.  Duggan took your evening meals in her quarters
in Assisted Living, rather than the dining area.  Dr.  Zorn and I feel
sure you'll understand our concerns."

It had been a terrible day for Muley.  First the disappearance of his
wife without his being told.  Then the two-hour search with Dr. Zorn.

Then the awfulness of finding her in the center of town with a mob
gathered around her.  And finally the disaster in the dining room.

"You think they were offended?"  he asked pleadingly.

"Terribly.  I was there," Krenek said.

"It was awful, Muley.  You could see the reactions of the diners."  He
had been going to say 'the revulsion of the diners," but had caught
himself in time.

"It can't go on, Muley.  The other residents have their own problems to
get through."

"But that's why we came here," Muley argued.

"Now you want to change the rules because some nervous women .. ."

"Muley," Krenek said patiently, 'the men reacted worse than the women.
I believe they were wondering what they would do if their wives .. ."

He surrendered: "All right, if you're banishing us from the dining room
... I did not bring her here to hide her away.  If your precious people
cannot stand to see how lives sometimes end up, more pity to them. I'll
keep her away."

He kept his word.  Occasionally he would allow her to be fed alone in
her room while he dined alone in Gateways or with old friends, and
sometimes when a man who had lost his wife saw Muley dining alone, the
man would find tears rushing to his eyes, for he knew that he never
showed his wife one half the love that Muley continued to give his. But
more often a lone man or woman, coming into the dining room and seeing
Muley sitting alone, would ask politely: "May I join you, Mr.

Duggan?"  and invariably during the course of the meal the visitor
would ask: "And how is Mrs.  Duggan?"  and he would reply, almost
convincingly: "Just fine.  She seems to do better every day."

One morning toward the end of August, when summer was waning, Nurse
Varney entered Dr.  Zorn's office without knocking, fell into a chair
and started sobbing.  Hastening to her side, he took her hands in his
and asked: "Is it Jaqmeel?"  and when she nodded, unable to speak, he
put his arm around her ample shoulder.

"Is the news really bad?"

"Mrs.  Angelotti called.  Said it looked like the end."

Not satisfied with a secondhand report, Zorn called the hospice and was
told: "We see a lot of these cases, Dr.  Zorn, and the two nurses agree
that this is it.  I looked in and doubt he'll last till nightfall."

"Have you been wrong before?"

"Many times.  With AIDS it sometimes looks like death from day one.
Remember, he was a star basketball player.  He could have reserve
power."

But when Zorn called Dr.  Leitonen, that expert said simply:
"Let's meet there in twenty minutes.  I may need your help."

The last words frightened Zorn, for he could not risk, as director of
the Palms, becoming any more deeply involved medically with a case of
AIDS than he already was, but when Nora implored him tearfully to go,
he felt he had to give her what comfort he could.

"Get in the car and we'll see what we can do."  To his surprise and
dismay she refused to leave her chair: "No!  I can't watch him die.  He
was the hope of our family .. ."  and she began sobbing convulsively.

Grabbing her roughly by her two hands, Andy pulled her to her feet:

"Nora!  You're the one who means most to him.  You've got to come!

You're his family-his last tie to this world."

With great difficulty she pulled herself together and they made their
way to her car.  When they reached the hospice, Mrs.  Angelotti said to
Andy: They're waiting for you upstairs," and Andy wondered why he was
needed.  Climbing the stairs almost reluctantly, he was surprised to
find Dr.  Leitonen standing by the bed and holding a Bible with a
bookmark protruding from it: "Mr.  Reed, you've begged me to tell you
the truth, and I'm telling it to you now.  The signs are not good.  The
tests I ran show a bad infection in both your kidneys and your
lungs."

"How many days do I have left?"

"Could be two, could be two hundred."

"But not two thousand?"

"I'm afraid not."

"And in increasing pain?"

"Yes, your systems are breaking down-all of them."

"Can you end it for me?"

"You know I'm not allowed-by my oath and the law."

"So, I've got to stick it out?"

"That's what you're supposed to do, Jaqmeel.  But I can ease your pain,
you know."

"No sedatives for me, Doctor.  I want to feel every minute."

Then you'll get none from me.  You're a brave fellow, Reed.  Has anyone
from the university been here to give you support?  The coaches,
maybe?"

They're gung-ho only when you're scoring twenty points and making six
steals from the other team."  Then, ashamed of such a bitter comment on
colleagues from his days of glory, he softened his tone:

"They're scared to death of AIDS.  You saw how the pros refused
to play with Magic Johnson.  College kids are just as jittery."  As
Zorn heard Jaqmeel talk he thought: What a waste!  And he wanted
desperately to ask: "How did you catch this disease?  A needle?  Some
girl?  Homosexual activity?  Blood transfusion?"  But no matter how he
might phrase his question it would be intrusive, moralistic and
offensive.  It had happened, and the tragic result made how it happened
irrelevant.

"So, you're alone?"  Leitonen asked.

"Not when my aunt is here."  He smiled at Nora with such overflowing
love that Zorn saw his nurse look away with shame at her earlier
cowardly refusal to come to her dying nephew.

At this point the final meeting took such a bizarre turn that Zorn
could never have anticipated it.  Dr.  Leitonen became once more the
devout Lutheran he had been as a boy, and in a slow, comforting manner
he said: "Mr.  Reed, I want you to see yourself as you are what you
represent-your place in history."

"I already know what I am, the guy who threw it all away."

"No, you're the young man three thousand years ago of whom God spoke in
Leviticus, and I want Dr.  Zorn to read aloud what instructions God
gave men like you in those days!"  He handed Andy the Bible, opened at
Leviticus 14, Verse 21, but before Andy could start reading, Leitonen
added a medical note: "The Jews of that day were afflicted by a plague
as devastating as your AIDS.  Scores of people died of leprosy, their
bodies falling apart, and there was no cure."

Emphasizing his words, he looked straight at Reed and said: "For five
thousand years there was no cure for their terrible plague.  But like
me today, medics did everything imaginable to halt the spread, to cure
those who contracted it.  Listen, Jaqmeel, to what God directed be done
to try to cure a penniless Jew five thousand years ago."

Before he gave the signal for Zorn to read, he took off his rubber
gloves and stood before Reed like some ancient priest, with bare hands
touching the boy's bare hands.  Then Andy read the instructions for
helping a poor man fight leprosy:

"And if he be poor, and cannot get so much, then he shall take a log of
oil;

And two turtledoves, or two young pigeons..  .."

When he came to the next verse Leitonen produced a vial of baby
oil, which he poured into the palm of his left hand:

"And the priest shall pour of the oil into the palm of his own left
hand:' As he was doing this, Andy looked ahead to the words of the next
verse, pathetic, prayerful ancient words that the Jews hoped would
combat their plague:

"And the priest shall put of the oil that is in his hand upon the tip
of the right ear of him that is to be cleansed, and the thumb of his
right hand, and upon the toe of his right foot, and upon the place of
blood..  .."

When Leitonen bent down, uncovered the young man's right foot and
anointed his big toe, only the gravity with which the doctor performed
this ritual suppressed Zorn's nervous laugh, and he continued
reading:

"And the rest of the oil that is in the priest's hand he shall put upon
the head of him that is to be cleansed..  .."

At these words Leitonen rubbed his greasy left hand in Reed's hair,
deeply and thoroughly, and then came the closing verse:

"And he shall offer one of the turtledoves, or one of the young
pigeons, such as he can get..  .."

And Leitonen pretended to release one turtledove and one pigeon 'such
as this poor young man could afford."

The watchers were dumbfounded by this display, but they remained silent
as Leitonen continued: "Jaqmeel, you are now one with the poor man to
whom God spoke.  Like him, you have been anointed, and like him you
have been part of a ritual that was as powerless to halt their plague
as my futile rituals are powerless to halt yours.  But you are one with
that penniless Jew and I am one with that sad, frustrated priest, and
may God have mercy upon us all."

"Why are you telling me these things?"  Reed cried weakly, hammering at
his sheets and fighting back a convulsive cough, and Leitonen said
softly: "Because I want both of us, you and me, patient and doctor, to
comprehend the nature of our plague.  Again and again through history
it has struck, and brave men have striven to combat it as best they
could.  You and I, Jaqmeel, are lost, futile souls, but we're part of a
parade that reaches back through thousands of years."

Zorn was watching Reed as the ritual ended and did not see that a
fourth figure had entered the cubicle.  Reed, who had apparently talked
with the newcomer before, welcomed him with a wan smile: "I'm glad
you've come to save me."  But Dr.  Leitonen, far from greeting the man,
grabbed his Bible from Andy and strode from the room: "Zorn, you can
testify.  I did not see this man; I did not speak to him.  I do not
know him."  He rushed down the stairs and slammed the door behind
him.

Mrs.  Angelotti's strong voice echoed: "Nurses, you can testify that
neither I nor Dr.  Leitonen saw him."

The stranger who had caused this volcano of action and denial was the
one whom Andy had glimpsed briefly that first day, the man in black
wearing the Borsalino hat.  When Zorn tried to leave the cubicle, Nora
surprised him by pleading: "Please stay," and he could not refuse.

"Name's Pablo," the stranger said in a midwestern accent that bore no
trace of either Italian or Hispanic heritage.

"I change it every week so you can deny you ever saw me, or helped me.
You saw the doctor run away.  He had to.  You heard Mrs.  Angelotti say
she never saw me sneak into her hospice.  You have courage, Doctor, to
stay."

When Zorn asked: "Why do they behave that way?"  the stranger jerked
his thumb toward the curtained window: "Because those two out there
with the camera keep an eagle eye on places like this," and when Zorn
peeked out, careful not to make the curtain move, he saw on the
opposite side of the street the same tall man and dumpy woman
maintaining their surveillance of the Angel of Mercy.

"Police?"

"Self-appointed.  Moral watchdogs on doctors, nurses and people like
me.  They're the ones who preach that all human life is sacred.

Under no circumstances can death be hastened or abetted.  They won't do
a damned thing to help Reed here, or find him a place to die in
dignity, but they insist that he struggle through eight or ten months
of hellish agony so that in the end he can die in the way they consider
proper."

When Andy peeked out again he saw the couple in a different
light.

Their self-righteousness angered him, but to his surprise Pablo
defended them: "When you remember how Hitler killed off anyone he
judged undesirable, like Jews, Gypsies and half-wits, you have to grant
that society needs watchdogs, and I accept that life is almost always
preferable to death.  But AIDS is different.  No one in this damned
nation seems to realize that.  AIDS is death in the midst of life,
inescapable and irrevocable.  The old rules simply do not apply."

"Why are you here?"  Andy asked, and he said in that flat nasal twang
that would have been at home in Texas or Arkansas: "You must be
kidding!  I've been in all the Florida papers.  They've nicknamed me
the Trusted Friend, but they have it wrong.  There are three or four of
us doing this work.  No one knows who we are and we sure don't know one
another.  We're a solution to a problem, and I'm probably the least of
the four.  But this fellow'-he indicated Jaqmeel-'knows me from the
other place," and when Zorn looked at the patient, he nodded, and the
man in black said: "In that dreadful place, they call for me often."

"For what?"

"Do you want me to say it right out?  The police are after me
enough."

Andy's fears were confirmed: the Angel of Death had been summoned by
Jaqmeel to help him commit suicide.  Wanting nothing to do with this
criminal action, Zorn tried to flee the cubicle and drag Nora with him,
but the Angel barred their way: "You two can help.  It's better if
friends remain," and from his bed Reed, too exhausted by the day's
events to sit up, lay back and pleaded with tears flooding his eyes:

"Aunt Nora, stay with me."

In his nasal voice the Angel consoled the man he had come to help:

"You were right, what you told me in that other place.  It's better to
leave at the right time and in the right way.  A cleaner bed doesn't
mean a cleaner life or a more appropriate death."

"What are you?"  Zorn demanded.

"You speak like a clergyman, or a lawyer, or maybe a teacher."

"You're partly right."

"Have you left my name anywhere?"

"So you, too, are afraid?  It's natural .. . You want to know what I
do-well, I was studying to be a high school principal.  Needed an MA.
and was close to getting it at a university I won't name, in a state I
won't name, either.  But then I watched two of my friends die with

AIDS, and it's terrible, as Reed will tell you.... When I saw
that these friends were forbidden to die in decency, I decided I didn't
want to teach children, I wanted to teach our whole society.  But I'm
only one of many, you know.  When churches and courts and hospitals and
the police refuse to do what's right, men like me spring up
everywhere.

This nation is racked by a terrible plague and we refuse to admit it.

Jaqmeel had to call on me as a last resort."

He went to the bed.

"Jaqmeel, have you reconsidered?"

"No," came the whisper.

"Of your free will you ask me for help?"

"I do."

"Will you tell your aunt and Dr.  Zorn that?"

"I want to go.  I can't stand it any longer.  This tunnel, there's no
light at the end."

Turning back to Zorn and Nora, the Angel said: "You're not to see what
I do.  You're not to remember anything but my name-Pablo," and from his
briefcase he took pills and a syringe and asked Nora to stand by the
bed, to allow Jaqmeel to hold her hand.  The doomed man took it to his
lips and kissed it: "You're kind to stay with me.  The others have all
gone," and he recited a line from a poem Andy did not recognize:
"About, about in reel and rout," and then he said: "I'm ready," and
Nora bent down to kiss him on the forehead.

But when she saw Pablo produce the hideous tools of his forbidden
trade-a white pill that might encapsulate a lethal dose of strychnine,
and the syringe that could inject a deadly dose of some potent drug she
understood with brutal clarity what was about to happen, and could not
bear it.  Cradling her nephew's head against her bosom she wailed: "I
cannot watch this, Jaqmeel!  You were our boy of gold..  .."

Collapsing in tears, she kissed him fervently, then allowed Pablo to
lead her away from the bed and direct her to the stairs: "It's best if
some of us don't see," and Andy heard his nurse clop her heavy way down
the flight of wooden steps.

All attention now focused on Jaqmeel, to whom Pablo handed two pills
with the crisp direction "Swallow them," and when with difficulty Reed
did, Pablo said: "Now let me have your arm," and the young man extended
an arm so thin it was painful to see.

"Look away," Pablo said softly.

"Both of you," so Reed and Zorn, clasping hands, stared at each
other.

Whether Pablo injected anything into the wasted arm, and if he
did, whether he used a placebo or some powerful drug, Zorn was not
allowed to know, but either the pills or the injection had an immediate
effect on Jaqmeel, for as he gazed at Zorn, still clinging to the
doctor's hand and grateful for his presence, his eyes slowly glazed
over, his breathing stopped, and he found his escape in death.

As Andy unloosed his fingers, Pablo said: "If the police come snooping,
describe me in full detail.  I won't be wearing this costume anymore,"
and he vanished, leaving Zorn with the dead man and the responsibility
of informing Mr.  and Mrs.  Angelotti what they expected to hear.  Zorn
saw that the back door had been left open so that the Angel of Death
could escape undetected from the hospice.

Like most retirement centers, the Palms had what the management called
'our little secret," for although the expensive entry buy-in fee was a
minimum of $110,000, two or three of the smallest rooms were available
on a rental system, just as if they had been part of an expensive
hotel.

Toward the end of August a rather odd person moved into one of the
rentals.  He was sixty-three and seemed much too young to be entering a
retirement facility.  His records showed that he was educated at Holy
Cross, had a law degree from one of the smaller night schools in
Cambridge and was the father of six children who lived in various parts
of the nation; his wife had died of cancer.  Dr.  Zorn noted the entry
which said that Clarence Hasslebrook had suffered, in his midfifties,
what his doctors described as 'a nervous breakdown occasioned by a
mixture of too much work and unrelieved tension."  Apparently the
tension had later been relieved, for in subsequent years he had
performed as one of the minor members of an undistinguished Boston law
firm.  Why he had quit what seemed to have been a lucrative position
was not disclosed.

Curiously, all arrangements for Hasslebrook's residence at the Palms
had been arranged not by him but by a woman member of his law firm, who
paid a year's rental in advance.  Administration did not

see the man himself before he moved in, but the woman assured
everyone: "You'll love this man.  He's one of the best."

Zorn, of course, was more than pleased to enroll yet another single to
occupy one of the hard-to-rent bed-sitting rooms, but when he met
Hasslebrook as the latter moved his meager belongings into his
quarters, he feared that he was welcoming an unknown quantity, for the
man had a shifty look and an apologetic manner that ill matched the
incongruous propriety of his dress.  In Florida heat he wore a New
England three-piece suit that looked a bit too tight, the trouser legs
a bit too short.  It had been carelessly tailored in a fabric that did
not hold its shape, and from long usage had acquired a sheen at
vulnerable spots.  He wore a nondescript blue tie that showed signs of
having been worn incessantly, and a pair of black wing-tip shoes that
needed polishing.  His appearance was definitely not that of the
typical Palms male inhabitant.  Also, he moved in an unusual manner,
leaning forward from the waist as if eager to make a strong impression
even on strangers whom he obviously did not really care to meet.  Zorn
saw him as one who warranted close attention.

When he first appeared in the dining room, Dr.  Zorn led him to the
long table, where he was quite out of place in his dark three-piece
because all the other men were in colorful tropical wear.  Raul Jimenez
and Chris Mallory were wearing pastel guayaberas and the other men wore
lightweight clothes of simple cut.  When the newcomer said, "I see that
dress goes by different rules here," two of the men volunteered to
guide him to the good shops.  He aroused further attention by refusing
to divulge anything about his previous life beyond saying: "I worked in
Boston.  Involved with minor business negotiations," which masked the
fact that everyone already knew, that he had been a lawyer.

Among the women he gained approval by ostentatiously rising from his
chair whenever a woman came to the table or left, and since this was a
buffet night, he was up and down like a jack-in-the-box until Senator
Raborn warned: "You keep on doing that, Mr.  Hasslebrook, you'll turn
into a yo-yo.  Besides, our ladies are not accustomed to such
gallantry."

"My mother made me do it.  I can't break the habit," he replied and
Senora Jimenez said: "Don't!  We women like to be reminded that there
are still gentlemen in the world."

"That name Hasslebrook?"  President Armitage asked.

"I can't place its derivation."

"It must be German," the stranger said, but unlike other newcomers to
whom Armitage had posed that question as a polite way to invite some
revealing account of family histories, the man volunteered nothing
else.

Armitage, whose former positions had required him to know as much as
possible about visiting professors whom he might want to bring to his
faculty or who were actually applying, was not satisfied with this
abrupt response: "I'd guess that the original ending must have been
something like bruch or burg.  Contaminated by American usage?"

No response.

"Or arbitrarily modified by immigration officials when your ancestors
came over?"  When even this elicited no reply, Armitage asked: The word
itself, as a word, or perhaps a combination of words?

Does it have any specific meaning in German?"  The man shrugged his
shoulders, and Armitage became so frustrated, and indeed angry, that he
refused to drop the subject: "I've often speculated about the
composition of my name.  Seems to have come over from France during the
Norman Conquest.  First part must have related to armament of some
kind.  Suffix tag el It must have related to an occupation or an act
like perhaps a man who supplied arms or sharpened them or heaven knows
what."  The man repeated his shrug, at which Armitage abandoned him.

Senora Jimenez was more charitable, influenced perhaps by the fact that
Hasslebrook had twice held her chair for her: "Sir, tonight's buffet.

No waiters.  You take your plate and pick the goodies you prefer. Here,
I'll take you," and she led the way to the far end of the dining room
where a generous assortment of hot dishes, well-prepared vegetables and
desserts awaited.  Under her expert guidance, Mr. Hasslebrook selected
a slice of prime roast beef, well charred; three vegetables not
overcooked; and the rich whole-wheat bread featured in any meal served
in John Taggart's establishments.  Because of his concern about
cholesterol the newcomer declined dessert.

In succeeding days the good-hearted inhabitants of Gateways spent
considerable effort in trying to make Mr.  Hasslebrook as welcome to
the Palms as they had been made to feel when they arrived, nervous and
insecure about whether they really wanted to settle in a retirement
home.  They remembered the warmth with which residents like the

down-to-earth Mallorys had extended unusual courtesies or the
enthusiasm that Senator Raborn displayed when trying to find them a
bargain in a used car.  And later they realized that Muley Duggan had
left his dazed wife to help them, even though he knew he would be
relentlessly abused when he returned to her.

Dapper Chris Mallory collared Hasslebrook after dinner one night and
said: "Old fellow, it's none of my business, but you're going to be a
lot happier here if you allow me to take you around to some of the good
clothing stores where you can find quite attractive summer suits.

They're usable all year long, you know."

Hasslebrook rejected the proposal: "I have two other suits.  I'll get
by."  But Chris was not one to acknowledge such a rebuff.  He knew that
Hasslebrook needed summer suits, and he knew where to find them at
prices that were not exorbitant, so one morning, without having
prearranged the meeting, he banged on the new man's door until it was
grudgingly opened: "Yes.  What is it?"

"I'm taking you to some of the finest stores in Florida, where you'll
find handsome clothes, reasonable prices."

"I really don't .. ."

"Come along!  You've got to learn the neighborhood if you're to enjoy
this place."  And almost by force, he edged Hasslebrook out of the
apartment and down to where the Mallory Cadillac waited: "That's my
wife's car.  Let's take yours," and although he knew he no longer had a
license to drive, he took the wheel of Hasslebrook's inexpensive rented
car.  As he again felt the thrill of driving a car he chuckled as if he
were a thirteen-year-old sneaking his family's jalopy out for a
spree.

At last Hasslebrook spoke.  If he was going to ride in Florida traffic
with a man who was clearly past his prime, he wanted to know the worst:
"How old are you?"

"Ninety, and my wife and I go dancing together at least twice a week
and as many other times as occasion provides."  Hasslebrook had no
comment, nor could Mallory guess what he was thinking, for he stared
straight down the highway as if he were either mesmerized or
terrified.

They stopped first at Mallory's favorite men's store, Klaus Ruger's,
where the Vienna-born outfitter imported the best suitings from Italy,
Spain, and England.  When Hasslebrook entered the store he was
astounded by the bright colors of the clothes and their suave lines,
but he was stunned when he looked at the price tags, for he found that
he could acquire a rather nice sports jacket for $495 and a pair of
appropriate slacks for $225.  "Are all the prices like this?"  he asked
and Mallory said: "The ones that Esther bought me for my birthday are
over here.  Fancier cut, better fabrics, they run in the six
hundred-dollar bracket.  Trousers are a bargain, though, at three
hundred forty dollars."  There were also some fine belts at $55 and
up.

"Do you buy clothes like these?"

"Of course.  Mr.  Hasslebrook, I'm ninety and I believe in indulging
myself-nothing but the best for me."  As a puckish smile crept over his
face, he said: "I'm having the time of my life, and enjoying my fine
rooms at the Palms..  .."

"You have more than one room?"

Three bedrooms-I need two for visitors.  But as I was saying, best
thing my wife ever did for me was getting us that Cadillac.  She drives
us to all parts of the west coast in the greatest comfort.  Beautiful
places here, clear down to Naples."

"Is there a store with more reasonable prices?  I admit I need a more
colorful suit, but I'm not approaching ninety.  I need to-' "Mr.
Hasslebrook, you are approaching ninety.  Everyone is, and just because
I'm closer to it than you doesn't mean that I live by special rules.
Live a little.  Get yourself four or five snappy jackets.  But I agree
with you-you don't have to spend five hundred dollars for one.  I'll
admit I enjoy special freedom.  I don't have to worry about the next
ten years.  One at a time is good enough for me."

With no adverse comment, he took Hasslebrook to another store, where
the prices were more reasonable.  For a jacket almost as flawless as
those at Klaus Ruger's the price was only $290, slacks at $115, belts
at $45 and up.  Mallory had expected the newcomer to grab two or three
of each, but when he saw the man blanch at the first price tag, Chris
knew that they had better move quickly to a lesser store.  Here the
price range was $240, $95 and $30, which was still more than
Hasslebrook was prepared to pay, so Mallory asked the owner of the
store where he might take his impecunious guest to find the kind of
clothes college students on limited budgets might buy, and the man
willingly cooperated.

"In the Hispanic section of Tampa, near those handsome buildings where
the Cubans made cigars, there's a clothing store tucked away in one of
the corners.  Called Charley's.  A fellow can find good bargains

there occasionally.  Manufacturer's overruns plus some very good
brand-name clothes that have slight imperfections-you'd never notice."
Having said this, the salesman fingered Mallory's lapel: "You didn't
get this at Charley's."

"No, Klaus Ruger's.  I'm helping him."  He pointed to where Hasslebrook
was still unhappily scrutinizing the prices in the store.

With no trouble, they found Charley's, but the first jackets they
looked at were still too expensive, $85 and $65.  But as Hasslebrook
turned away he saw a sign: FACTORY SECONDS.  YOU'LL NEVER SEE THE
IMPERFECTIONS.  This was what he wanted, and when he fingered through
the racks, $35 cheapest, $55 highest, he found an attractive jacket
with a true Florida look: "I like this one, if it fits."  The owner
helped him slip into the garment and said suavely: "It must have been
tailored knowing you were coming," and the purchase was made.

"Now, which others do you want?"  Mallory asked, and Hasslebrook said
in a surprised voice: "This is the one I like."

"But at these prices you ought to get three or four.  Different nights
of the week, you know."

"How many do you have?"

"About a dozen.  Maybe fifteen.  Can't look stodgy when I go
dancing."

"You still buy new jackets?  At your age?"

"What else am I going to do?  I like to look neat, "with it" as the
kids say.  And I intend looking that way as long as I live.  Doctor
told me the other day: "Your vital signs would do justice to a man of
sixty."

While they stay firm I dance.  But Doc said: "Maybe it's the other way
around.  Maybe you look so good because you do dance."  ' Hasslebrook
resisted the siren call to buy the four or five great seconds that
Mallory and the manager picked out for him, suits with damages so minor
that only an expert could recognize them if they were pointed out, and
he was also satisfied with one pair of trousers at $19.50 with a belt
sewn into the waistband.

"It was," he told Mallory on the drive back, 'a very successful
morning."

When he entered the dining room that night, Senora Jimenez greeted him
with applause: "You look spiffy.  My husband doesn't have a
jacket-and-pants set that looks half as good as yours," and this was
true, because Raul's matching sets at two hundred dollars each lacked
the high styling of the seconds from the prominent manufacturers.  Of
course, when Hasslebrook appeared night after night in the same
clothes, people began to talk, and one evening when Chris Mallory was
dining with the men of the tertulia, his wife being absent at a church
meeting, he told them about the almost fruitless shopping expedition
with the new man.

"What do you make of him?"  President Armitage asked, and Chris said:
"He's a jerk.  Should never have come to a place like this."

That we knew from the first night," St.  Pres said, 'but is he a
dangerous jerk?"

"I thought he was merely stupid."

"He did graduate from law school," Armitage said, and St.  Pres
remarked: "So he says."

The upshot of Mallory's report was that Armitage and St.  Pres asked
for a meeting with Dr.  Zorn, and when they sat down in his office they
wasted no time in getting to the point: "Zorn, what's the story on this
Hasslebrook?"

"Anything I know is public information.  Boston lawyer in a minor
partnership.  Credit rating good.  No suspicious entries in his track
record.  Wife died some years ago, nothing suspicious.  Had six kids,
all married, and he wanted a southern climate.  Tired of shoveling
snow."

That's all?"

There was one unusual aspect to his coming here.  He never visited us.
A woman from his office flew down, inspected us meticulously and spoke
to Ken, who made all the arrangements."

"What do you make of that?"

"Obviously he's not your standard old widower with his CD collection,
his Cadillac and three grandsons at Yale.  He's something very
different, and if you discover what it is, please let me be the first
to know."  When he led his guests to the door he added: "You men know
that at the Palms we do not snoop.  We assume that we're dealing with
gentlemen and ladies, people trained to be civilized."

After weeks of watching Hasslebrook wearing the same jacket and
trousers, Chris Mallory once again knocked on his door: "Mr.
Hasslebrook, you and I had a profitable trip some weeks ago.  You found
a jacket I'd be proud to wear myself.  But you can't live here with
just one pair of trousers.  Sit down.  I want to talk like a trusted
friend, and no one will ever hear a word of what I'm about to say.  You
were surprised at Charley's when I said I had fifteen or so sports
combinations.

Actually I have eighteen, and three of them I've almost never
worn here at the Palms.  They'd fit you, they'd look great on you, and
I would be honored, Mr.  Hasslebrook, if you'd accept those three
jackets and the trousers and the belts as my gift to a man who could
wear them with distinction."  He held his hands forward, palms up as if
he were in the desert proving to a stranger that he carried no
concealed weapon.

The effect on Hasslebrook was striking.  Lowering his head as if to
hide deep emotion, he said: "You are truly generous-I'm deeply moved,
Mr.  Mallory.  But I have plenty of money, I did well in my firm.  It's
just that I detest exhibitionism, display, ostentatious spending.  If
you came at me with hot irons you couldn't force me to pay my money for
those suits at that first place, the Austrian one.  When I got such a
suit home and looked at it, I'd burn it.  Wouldn't risk having it
contaminate me."

"Are you a New England Puritan?  You believe in self-flagellation."

"I was nothing.  My wife was Catholic.  I learned a great deal from
her."

"Did she help you to convert?"

"I'm still not affiliated with any church.  I did go to Holy Cross,
where I learned to be a practicing Christian.  I do not believe in
vanity."

"I'm a Baptist, not a particularly good one, but I am.  So let's talk
sense like two fellow Christians.  Mr.  Hasslebrook, if you intend
staying here at the Palms-' "I do."

"You cannot do it with a wintertime three-piece suit and one summer
pair of pants.  Get in the car with me right now, I'll advance you the
money if necessary, and we'll go back to Charley's and buy you those
three or four great jackets I picked out that day.  If you agree to buy
so many, I'm sure he'll give you a good deal.  Well under two hundred
dollars."

Hasslebrook studied the proposal, then asked: "You think it's
necessary?"  and before Chris could reply, he added: "Have the women
been talking about me?"

"Not my wife.  She talks about nobody."

"The others?"

"Yes."

"I'll go.  You think two hundred dollars will make me presentable?"

"Yes, and I'll lend you the money."

"No need."

They drove up busy Thirty-fifth Street to Charley's, where Mallory
said: "Mr.  Charles, as a personal favor to me, I want you to pick out
for this gentleman four of your very best factory seconds: sports
jacket, trousers, belt, and the bill has to be no more than two hundred
dollars."

While Hasslebrook inspected the four jackets, Mallory whispered to
Charley: "If it has to go over the two hundred dollars he has, I'll
make up the difference," and in that way Clarence Hasslebrook, a dour,
secretive man, was able to appear in the dining room in five different
handsome outfits; his three-piece dark woolen suit was reserved for
Sundays, when he attended one of the nearby churches.

On the last day of August when temperatures in Florida should have been
blistering, Andy realized that it was an exceptionally comfortable day
for checking the grounds, which he had wanted to do for some time.
Walking around, he paid special attention to the walkways, the flower
gardens and the swimming pool.

He was feeling pleased with his custodianship when he turned a corner
to inspect the tennis court and saw a sight that stunned him.  On the
far end of the court stood Bedford Yancey, dressed in tennis shorts
with racket in hand.  Opposite him on the near end were two women, also
in tennis gear: his wife, Ella, who was obviously capable of playing a
decent game of tennis, and Betsy Cawthorn, in her new fully fleshed-out
legs.  It was as if some master sculptor had re-created the shapely
legs that Betsy had had before, but the new legs terminated in rather
large, heavy shoes with flat soles that held firmly to the ground.  She
was standing with the right foot forward and well to one side, the left
foot slightly back and off to the other side.  In her left hand she
held a stout cane with a big rubber base that provided her with maximum
stability as she moved her torso and arms to return the softly hit
balls that her rehab director was sending her way.

But she did not pat the balls back to him.  She hit them smartly,
getting her entire upper body into the action, and even though she
could not run around the court chasing balls, she could from her stable
position manipulate her right arm and stretch herself from the waist up
to reach balls that Andy thought she must surely miss.  When a ball
from Bedford went wide, his wife ran to recover it, but when a shot
missed Betsy and came at Ella, she could handle it with dispatch.  The
three were engaged in some strenuous rallying, as though they were
warming up for a game.

"Marvelous!"  Andy shouted as Betsy reached far to her right to return
a shot.

"This is miraculous!  Betsy, you're playing like a champion.  I can't
believe it!"

The players stopped to acknowledge his presence, and Ella suggested:
Take that seat over there and watch our girl demonstrate her new
skills."  He accepted the invitation and sat close to the mid court
steel post to which the net was attached, and for a quarter of an hour
he watched as Betsy hit shot after shot that Bedford launched her way.
He noticed that as she became more skilled at the task of maintaining
her stability, she gained more freedom of movement.  At the ten-minute
mark she became almost a free spirit on the court, making recoveries
Andy had earlier thought impossible.

She wore an imported Teddy Tingling-like white tennis dress favored by
chic players, and as Andy studied the outfit and how perfectly it
suited her, he was suddenly struck by how beautiful she was, and- an
inner voice said-how sexy.  He had never before allowed himself to
think of her in those terms.

At this point, Ella stopped the play on the court and proposed: "Dr.

Zorn, why don't you take my racket and play?"  He was about to decline,
since he had no tennis shoes, when Betsy said urgently: "Doctor,
please!  We need you," so reluctantly he took over as her partner.

The next moments were dreamlike.  Never a superior tennis player, Andy
at least knew how to handle a racket and defend himself at the net, and
with Betsy standing firmly at his right side, he entered the game
vigorously, moving about to field balls that Betsy could not reach and
chasing to recover balls they both had missed.  But as the exchanges
continued, Betsy grew bolder, and when Yancey sent a ball well to her
left, to her backhand, Andy gallantly moved slightly to his right to
play it but was halted by a peremptory cry from Betsy: "Mine!"

and she thrust her racket boldly across her body to take a swinging
smash at the ball.  She maneuvered so cleverly, throwing additional
weight on the cane, that she completed the shot almost brilliantly.

Grinning at Andy as she moved her cane back to its position for maximum
stability, she said impishly: "I always had a strong backhand," and the
game proceeded.  But as she became more confident, she continued to
stretch out to her left to deliver backhand shots, and she became adept
at moving her body weight about in an almost free and easy manner.

She was so exhilarated by her performance that after two backhand shots
she called to Yancey: "Feed me a couple straight on," and when he did
she amazed everyone, including perhaps herself, by raising the cane off
the court, standing only on her two flat-soled shoes, and punching the
balls back across the net without any teetering of her body.

They're behaving like real feet!"  she cried joyously as she took a
hard swipe at the ball, but the effort proved too demanding.  At the
completion of her vigorous swing she had moved so much that her new
legs could not ensure her stability and she began to fall.

"Catch her!"  Yancey shouted as he ran forward.  Ella, too, leaped from
her chair to keep Betsy from falling to the hard surface, but their
help was not required because Andy lunged forward, caught her about her
waist and pulled her to him.  For a breathless moment they stood
clasped together.  This time she did not kiss him, but her left arm,
still holding the cane, pressed him closer to her as she whispered: "I
wasn't afraid.  I knew you'd be there to help if I fell toward your
side."

Andy was so enchanted by all that had happened during the last half
hour that he cried impulsively: This day has been too wonderful.  Let's
prolong it with lunch together in my office!"  As the four happily
walked back to Gateways, Yancey engineered it so that Betsy remained
with his wife while he fell behind with Andy, and when they were
sufficiently separated that Betsy could not hear them, Yancey said:
"You could see for yourself, Andy, that Betsy's made extraordinary
progress.  I'm sure she's ready to test her recovery in the real world.
And I'm going to recommend that she reenters it-unless an unforeseen
reason develops for her to stay with us a bit longer."

Andy was stunned-the pain of her leaving the Palms, and him, would be
insupportable.  Everything had changed during the last hour at the
tennis court.  Medically, he supported Yancey's reasoning: "It's time
for her to return to her real life," but emotionally he could not let
her go.

With difficulty he managed to regain his composure before joining the
women in his office.  Telephoning Nora, he asked her to arrange a lunch
party for the four of them plus herself, Krenek and Miss Foxworth. When
all were gathered at the table Andy started the informal discussion:
"Our Betsy has just about completed her course of rehabilitation here
at the Palms, and we ought to give some attention to what she should do
next."  After a pause, during which everyone looked at Betsy, Miss
Foxworth said: "When you go, Betsy, it will leave a terribly big hole. 
We've all grown to love you so much.  But I suppose you really must
return to Chattanooga and resume your real life."

Yancey added: "Betsy, you've graduated rehab with honors," and his wife
agreed: "An admirable student.  You need to keep up a scaled down
version of your exercise program, but Yancey and I know a couple of
good physical therapists you could work with in Chattanooga."

Ken Krenek said: "You've acquired a lot of things during your stay with
us, Betsy, but if you send us a Chattanooga trucker, we'll pack for
you," and Nora cautioned: "When you reach home, don't go into isolation
again.  Get out into the community and make yourself a part of it."
Andy added: "Keep in touch with us.  Let us know how you're doing,
because we don't want to lose contact with somebody we all love."

At last Betsy spoke to these good people who were planning her life for
her.  In a very low voice, not much more than a whisper, she said:

"But I'm not going back to Chattanooga."

Everyone was astounded by this declaration, made with such firm
resolve, but it was Miss Foxworth who responded first: "Betsy, your
recovery here has been remarkable.  We've all been cheering.  But
you're not ready to strike out completely on your own.  You must stay
close to your family and friends."

"That's what I'm doing.  I'm staying here," she said in the same low,
determined voice.

Somewhat uncertainly Miss Foxworth said: "Well, we do have the room to
accommodate you," and Mr.  Krenek said immediately: "Or we might find
you quarters that would fit your needs better."

When everyone had contributed thoughts on how Betsy should spend the
remainder of her life, she sat quietly, with downcast eyes, her hands
clasped about a Coke bottle, and said thoughtfully: "I found a

home here.  I found dear, trusted friends who saved my life, my
sanity.

And I found a pattern of living that made sense.  I'll be the youngest
resident you have, far too young, but I want to live a life of service,
the way Berta Umlauf does, or my dear friend Nora Varney, or my miracle
man Bedford Yancey."  She paused and said tearfully: "I guess you're
stuck with me, Dr.  Zorn."

Of all those who listened to this explanation, only Nora could
appreciate its full significance: Brave kid, she wants to stay right
here and fight it out.  She wants her man and no power on earth is
going to get in her way.  I wonder if Andy realizes the meaning of what
she's just said?  And when she looked across the table at the doctor
she thought of the street phrase her nephew Jaqmeel had often used:
"Poor zombie, he don't know from nothin'," and she felt sorry for him,
and for Betsy, too, and for the battles that lay ahead.

When the lunch ended, Andy was left alone in his office with the
radiant afternoon sun flooding the room, and he sat once again at his
desk trying to sort things out.  Far more than Nora had concluded, he
was aware of how things had changed since those dramatic moments on the
tennis court when he had seen Betsy not as a patient but as a highly
desirable woman.  The image that persistently came before him was that
of Ted Reichert, the young doctor in his clinic who had destroyed
himself, his marriage, his job and even his welcome in Chicago by his
improper relationships with his patients.  Worst of all, Andy thought,
he had ruined or at least seriously damaged the lives of those
patients.  And he knew how infinitely worse his case would sound in the
headlines: DOCTOR PREYS UPON RICH DOUBLE AMPUTEE LEFT IN HIS CHARGE.

And Betsy?  She must be scared, confused.  She thinks she wants to stay
at the Palms, but that's crazy.  She's a quarter of the age of some
patients.  She's got a whole wonderful life before her.

Abruptly he called Krenek, Foxworth and Nora back to his office, and
when they were seated he said with considerable force: "I'm afraid
Betsy's plan to remain here with us is a daydream on her part and apt
to get the Palms into all kinds of trouble.  So I want you three to put
an end to this idea.  It'd be ridiculous for her to stay here at age
twenty three

"How do we convince her?"  Krenek asked, and Zorn said: "You'll be able
to think of something."

Miss Foxworth spoke first: "I'm of two minds.  As the woman in charge
of collecting the fees and keeping us solvent I want to see Miss Betsy
remain right where she is, with her father in Chattanooga sending us
those big checks.  But woman to woman, I'd have to advise her to get
out of the Palms with its horde of old people.  She must return to her
own group, with its marriageable young men."

Bluntly Nora asked: "When you were her age did you ever take a job
where there were no available men?"  and Miss Foxworth said crisply:

"Yes.  In Washington-and the years passed.  She should get out of
here."

When Zorn asked Nora what she thought, she said cryptically: "I believe
Betsy has a strong will.  I think she'll insist on staying here, no
matter what we say."

"But I just told you that our decision now is for her to go-to get out
of a place that isn't suited for her."

"But if she won't go?"  Nora asked, and he said lamely: "We'll think of
something."

When they returned to their offices, leaving him alone, he continued
sitting, deep in thought as he drummed his fingers for some moments on
the desktop.  He looked at the chair Betsy had occupied during the
earlier meeting, and saw her once more in the charming tennis outfit
and relived the moment he had reached out to prevent her from falling
and embraced her.  He felt a tremendous yearning for her, and he was
shaken by the depth of his emotions.  And then the image of Ted
Reichert and the many lives he'd ruined came before him, and it was
these conflicting images that kept him awake during most of that
night.

DEPARTURES

OFFICIALS AT THE PALMS might not have been so quick in uncovering the
reasons for the unusual way in which Clarence Hasslebrook had rented
quarters in Gateways and his curious behavior once he moved in had not
the Duchess penetrated the mystery by her propensity for snooping.  In
fact, the arrival of a mystery man like Hasslebrook had whetted her
appetite for the chase, and she used the same tactic as she had in
discovering that Reverend Quade was an author.  One morning the postman
arrived earlier than usual, and the Duchess, from her vantage point in
ground-level front, saw him wheel into the oval, park his postal van in
the space reserved and hurry into the lobby, where he distributed the
letters in the boxes and then stacked the half-dozen larger packages in
the customary space outside the locked area.

As soon as he had gone the Duchess swept out of her apartment wearing a
French-style lace peignoir over her nightgown, hurried to the stack of
packages and rummaged through them, taking note of who was receiving
what, and after finding little but the regular sort of thing arriving
for the regular sort of recipient-L.  L. Bean catalogs for the men,
Neiman Marcus for their wives-she struck what she recognized as a gold
mine.  It was the first package ever received for newcomer Hasslebrook,
and it was the kind that looked as though it contained either a pair of
oversized books or a collection of papers that should not be folded.
Hefting it in her left hand, she decided it was neither, but what it
might be she could not guess.  She did, however, take careful note of
who had mailed it: Life Is Sacred, Beacon Street, Boston, Mass.  The
name was familiar; she had heard about this organization before.

She became so tantalized by the question of why Life Is Sacred might be
sending a package of this size to Hasslebrook that she was sorely
tempted to sequester it before the staff arrived and sneak a glance
inside to see the contents, but she decided that this was too risky and
illegal to boot.  But she did take the package into a corner of the
room, bend way over to hide what she was doing and use her sharp
fingernails to force a small opening in one corner.  It was big enough
to allow a glimpse of the contents and to permit her clever fingers to
work one item free and out through the opening she had made.  It was a
pamphlet, attractively printed, with a cover that showed Jesus on the
cross and the bold words HE DIED THAT WE MIGHT LIVE and the name of the
issuing society: Life Is Sacred.

When she was back in her room, with the postal truck gone and the staff
beginning to arrive, she sat by the window and studied her discovery.

It was a well-written, handsomely illustrated religious tract defending
human life against the enemies that threatened it: abortion, drugs,
suicide and, especially, legal euthanasia.  The position of the society
was uncompromising; such actions were immoral, counter to the teaching
of the Bible and illegal.  Those who were members of the society were
commanded to fight the good fight against the enemies, those who were
not yet affiliated were warmly invited to join and to carry the battle
into their own communities.

She noticed that Mr.  Hasslebrook's name appeared nowhere as an officer
of the society, but the pamphlet did boast that they had more than two
thousand members nationwide.  It was an impressive document, and she
stayed by her window between the hours of nine to ten wondering what
she should do with it.  She concluded rightly that if she revealed that
she had a copy she might have to explain how she had acquired it, but
she solved that problem quickly by burying it under some clothes at the
bottom of a small suitcase in her bedroom.

Then she wiped her hands as if they needed cleansing and strolled
casually into the main office, where she asked Nurse Varney if she
could have a few words with Dr.  Zorn.  When she sat with him, smiling
with the innocence of a child, she said: "We've all been wondering what
this Hasslebrook character might be up to, and I think I've stumbled on
the answer.  In picking up my mail this morning I happened to notice
among the boxes outside the door of the locked part of the post office
a parcel addressed to him.  I wasn't snooping, the name just popped up
at me, and I was interested in who might be sending him such an
important-looking parcel."  She paused for effect, then said quietly:
"A society in Boston.  Life Is Sacred.  I wondered why they would be
interested in a nonentity like Hasslebrook."



in "Do you happen to know what sort of society they are?"

"Surely you've heard about their performance in the Montana case, the
one where they were the force that kept that poor girl alive when her
parents wanted to end her life?"

"Was that the agency?  They got a lot of publicity in that one."

"They're very good at organizing publicity."

"How do you know so much about them, Mrs.  Elmore?"

"Many of us older people think of them as our protectors.  Against
being put to death before our time.  Avaricious relatives wanting our
money.  Someone has to look after our rights."

"Have you any relatives who are-avaricious?"

"Several in California.  I wouldn't leave them a nickel.  I have my eye
on missions to the Eskimos."

"Well, thank you for your interesting news," and he ushered her to the
door, even though she had shown no sign of wanting to leave.  She liked
Zorn and appreciated an opportunity to talk with him on community
matters, so as she left she said: "If I can be of any help on the food
committee, let me know.  My husband and I had a cordon bleu chef at our
home in France and I remember a few things he taught me."

When she was gone, Andy leaned back and studied the ceiling.  It seemed
that wherever he moved, whatever he did, he was catapulted into the
middle of some medical problem that he would have been pleased to
avoid.  Now it sounded as if he would be called upon to defend the
integrity of retirement centers, for he had no doubt that Hasslebrook,
whoever he was, had been inserted into the Palms to spy upon operations
in the health center.  And he wondered whether he should have a
discussion with the man right now, so that the battle lines in whatever
struggle might ensue were understood.  He was strongly inclined to
react quickly and firmly, but first he would seek the guidance of Ken
Krenek and Nora Varney, experienced hands who would be just as eager to
protect the Palms as he was.

"Now, I don't want anyone to panic or jump the gun, but the Duchess
told me that our Clarence Hasslebrook looks to be an agent of the Life
Is Sacred movement out of Boston.  He received in the mail today a
large packet of what she suspects was printed material from his agency.
What do we know about his group?  What should we do about having him in
our midst?"

Krenek was eager to speak: "Very powerful.  Very persuasive.  They
publish good materials and seem to be growing in strength."

"What specifically might they do here at the Palms?"

They raised merry hell with the nursing homes in Texas.  And I must
say, some of them deserved it, and they were complimented for having
done a public service.  In some of their other interventions?  Well, I
got the idea they were interested mainly in publicity for their various
causes."

"Which ones might apply to us?  Why would he be here?"

They're fierce opponents of anything in care for the aged that smacks
of terminating a human life."

Andy interrupted: "I've read somewhere they're masters at using the
courts-' "None better," Krenek said, "I've studied a couple of their
cases in the newspapers, and their method is to tie you up.  Positively
hog-tie you, so you have to play by their rules."

"What would be your guess as to why he's here?"

"Obviously he wants to check us out, but it could well be that he's
chosen us because we're part of Taggart's chain.  Put him down as an
industrial spy."

Andy considered this and said: "You may be right.  Now, what do we know
about this particular fellow?  Let's look at everything.  Even little
bits.  Nora?"

The high school waitresses report he's a bore.  Sits there and never
talks."

"How old is he?"

"Mid-sixties?"  Nora guessed.

"Ken, how was it exactly he came here?"

"I handled the case.  Woman lawyer from his firm in Boston took care of
arrangements.  She wanted it for one of their staff who lost his wife,
kids all married."

"Kids?"

"Yes.  Six, as I recall.  His financial condition we didn't look into,
since the law firm paid everything and the woman assured me he had
small investments on the side.  But I'm not so sure.  We might want to
bring in Chris Mallory.  He took him shopping for a new suit, and his
report of what happened is hilarious."

"In what way?"

"Makes Hasslebrook a real dope.  Highest he'd go for a sports coat,
which he needed, was thirty-five dollars at Charley's, that outlet in
the Spanish quarter that specializes in factory seconds.  So I judge
he's not loaded."

"What to do?"  Andy leaned back, looked over the heads of his
assistants and for some moments contemplated this unwelcome
development.

Krenek suddenly cried: "I think I have it!  In that famous case in one
of the western states, a representative of Life Is Sacred butted into a
family problem.  The parents were trying to exercise their brain-dead
daughter's wish expressed years before that she never be kept alive
when meaningful life has vanished.  And damned if he didn't get a court
order making him custodial guardian of the young woman, and he
absolutely stopped the parents from doing what they had promised, to
let the girl die."  He paused dramatically, then said: "I'm sure I
remember that agent's name as Hasslebrook.  If he did it out west, he
can do it in Florida.  Get a court order and take all our options away
from us."

Nora said: "Florida courts aren't going to put up with that nonsense.

Too many old people come here expecting protection," but Krenek said:
Trouble is, they might get the idea that Hasslebrook is protecting
them.  On paper his ideas look good, but they raise hell with private
lives.  Yes, now I remember.  There was a two-hour television play on
that western case.  Pretty gruesome from our point of view."

Andy, listening to this ominous news, concluded that Hasslebrook's
intrusion could mean only trouble, for him, for the Palms and maybe
even for the Taggart interests.  What kind of trouble remained to be
defined, but Andy had a strong intuition that it would be best to have
that definition take place right now.  He sighed heavily: "To think I
came down here to get away from this kind of legal nonsense."

After a pause he placed both hands on his desk, pushed himself back and
said: "Ken, go fetch him.  We'd better find out up front."

Krenek did not leap to the door.  Instead he warned: "Andy, do not lose
your temper with this man.  You and I have seen only one aspect of the
fellow, an aspect he's carefully presented, the dumb boob.  That he is
not.  Believe me, Andy this man is dangerous-to you-to me-to the whole
Taggart chain."

"You've convinced me of that, which is why I want to Confront him now,
at the start."

"Nora," Krenek asked, 'what do you think?"  but before she could reply,
Andy said quietly: "In a case like this, where we're dealing with what
looks like real danger, it's what I think that matters.  It's my
responsibility, and I've lived by the rule of meeting danger headon."
He laughed and added: "And look where it's got me.  Kicked out of
Chicago and now maybe out of Tampa.  But here goes.  Fetch him, Ken."

When Krenek brought Hasslebrook into the office, Andy moved forward to
shake hands and said: "I'm sure you've met my nursing assistant, Mrs.
Varney, and you met Mr.  Krenek when you applied-' In some
embarrassment he corrected himself: You've not met Krenek, have you?
Your entry was arranged by a member of your staff in Boston.  Well,
this is Kenneth Krenek, and now if you'll leave me with Mr. Hasslebrook
we can go about our business."  The dismissal was not well handled and
everyone knew it, but the others filed out.

They were alone together for the first time: Clarence Hasslebrook,
sixty-three years old, slightly overweight, slightly disheveled, and
Andy Zorn, thirty-five years old, trim in his lightweight Florida
summer suit, obviously able and eager to avoid trouble if possible.  He
proposed to find out.

"One of our residents informed me this morning that when she went to
get her mail she saw next to her package outside the post office door a
large package addressed to you, and she couldn't help noticing that it
came from an organization she knew well, Life Is Sacred, with its
office in Boston, I believe."

Hasslebrook leaned back, smiled and said: "So it was you who cut the
corner of my package and sniffed inside.  I suppose you know, Dr.

Zorn, that you could go to jail for that?"

Zorn was stunned by the speed and daring that Hasslebrook showed in his
willingness to engage his target front ally but he did not flinch: "I
assure you, as director of the Palms I'd never commit such an act.  So
let's not start by making threats.  What I'm entitled to know, as the
man responsible for the management of this place, is whether you are an
agent of Life Is Sacred, and if so, why you inserted yourself in here
as a kind of spy.  And most important of all, what specifically are you
spying on?"

Hasslebrook smiled, then pointed out that Zorn had asked 'three
monumental questions," any one of which could be considered quite

intrusive on Zorn's part and something he was not obligated to
answer.

Zorn broke into laughter, then said: "They told me you were a dullard.
Couldn't put three words together.  Obviously not true.

Actually, you're too damned clever for your own good."

"Holy Cross, Boston Law and not particularly clever, but very
determined."

"Help me-determined to do what?"

"To check into the operations of a high-class nursing home."

"A phrase we never use."

"But the public does, the courts do.  And believe me, Dr.  Zorn,
nursing homes bear looking into."  Pausing just a moment, he asked:

"Doctor Zorn?  Are you in charge of medical services here?  Are you the
resident physician?"

Andy smiled: "Come on, Mr.  Hasslebrook, you know the answers to your
questions better than I do.  I am not licensed to practice here in
Florida, and as you must surely know, retirement centers in this state
rarely have resident physicians.  We rely on those in the surrounding
community."

The two men had reached an impasse, each having established the fact
that he was not going to be bullied by the other.  Andy broke the
silence: "All right, Mr.  Hasslebrook, let's get down to procedures.
You are, I take it, an important member of your group?"

"Not an officer.  But a trusted member.  And we're determined to police
nursing homes and places like them to ensure that old people are not
being abused-and hastened to their deaths."

"That's your job here?"

"Yes, and in the other establishments in this community."

"Your committee is spending a lot of unnecessary money to lodge you in
this place.  Why not some less expensive boardinghouse?"

"Our society has funds to spend on worthy purposes.  They wanted an
inside view of how a luxury place like this functions."

"I can show you right now, save you a lot of money."

"I don't want to see your version of your behavior.  I want to see our
version of your misbehavior."

"I can't persuade you to make your headquarters elsewhere?  It'll be
embarrassing to have you here, embarrassing to both of us."

"If you even suggested throwing me out, there'd be a lawsuit, and a
very ugly one indeed.  And you would lose, because there's magic in our
name.  Life Is Sacred.  That's not only true but it's something the
public responds to deeply.  Dr.  Zorn, do not, I beg you, pit yourself
against me in a courtroom, because, I assure you, you'll lose."

Andy had heard threats like that before, and twice the lawyer making
them had been right, he had lost.  He felt himself being hemmed in, but
since he'd been in that position before, he did not panic.  Instead he
asked: "So what is our relationship to be?"  and Hasslebrook replied:
"An amiable one.  I have my job to do, surveillance.  You have yours,
to protect the reputation of your establishment.  If your people are
not engaged in evil practices, you'll have no problems with me, but if
they are, you'll have real problems."  He stuck his hand out as if to
signal that honorable warfare had begun, but the gesture was fruitless,
because Andy, in a flush of anger, unwisely refused to take the hand.

Hasslebrook, proving that he was more skilled in these matters than
Andy, smiled, withdrew his hand and said pleasantly as he departed: "I
believe you, Doctor.  I'm satisfied that you did not pilfer my mail.
But someone in your organization did, and that's not a reassuring way
for us to begin our association."

In September, as World Series time approached, the men of the Palms
received exciting news that gave everyone pleasure.  On Long Island
close to New York City a group of baseball fanatics made their living
by trading in the little playing cards showing the notable big-league
players dating back to the early 1900s.  These cards, such as the
extremely rare one of Honus Wagner, the Pittsburgh man who was the
greatest third baseman of all time, brought fabulous prices, up in the
hundred-thousand-dollar range, but later stars like Mickey Mantle also
fetched high prices-say, in the forty-thousand-dollar class.  Baseball
cards were big business.  This year the dealers in the Long Island
district had organized what they ballyhooed as 'the mother of all card
conventions," a three-day extravaganza at which timeless heroes such as
Stan Musial, Whitey Ford and Mickey Mantle would appear to autograph
baseballs in person, often for as much as seven or eight

dollars a signature.  A lot of money changed hands at these affairs,
and this one promised to be the gala of the past five years.

One of the organizing dealers had the excellent idea of inviting the
only surviving hero of that 1929 World Series game in which the
Philadelphia Athletics scored ten runs in one unbelievable inning.

"His name," the clever manager told the committee, 'is Buzz Bixby, and
they tell me he's living somewhere down in Florida, sharp as a button
and loves to talk about that historic game."  When others who had not
been born when Bixby was a star player agreed that bringing him north
might give a real boost to the convention, the principal organizer
said: "It would cost us peanuts to fly him up here.  We'd put him up in
my brother's motel, no charge, and we'd get a world of coverage in the
sports section of the New York press, maybe television, too."

So inquiry was made in Florida and the Long Island men learned that
Buzz was living in the Palms.  Commissioning a Florida dealer to speak
for them, they authorized him to engineer a deal whereby Buzz would fly
north for the three-day fiesta.  When the dealer visited the Palms to
extend the invitation, he also talked to Zorn and saw at once the
reasonableness of the doctor's request for taking precautions and faxed
his Long Island colleagues:

Buzz Bixby in good health, has all his marbles.  Loves to talk about
the game.  But at his age his people will not allow him to fly alone.
Sensible and I agree.  So you must provide two round-trips to La
Guardia.  If so, it's a deal.

The Long Island men had already received ample publicity on the rumor
that Buzz Bixby might attend.  Realizing that if his visit fell apart
over an extra airfare from Florida, their big venture might turn sour,
they promptly authorized their Florida contact to provide the two
round-trip tickets.

The problem then became who should take Buzz to Long Island and bring
him safely back.  Both Ken Krenek and Bedford Yancey pointed out that
they had long been baseball addicts and would be pleased to spend the
required five days in the New York area, and it proved difficult to
make a choice between them.  The impasse was resolved by Dr.  Zorn, who
said that Buzz ought to be attended not by someone who would merely
carry his suitcase but by someone with medical experience.  Krenek and
Yancey bowed to authority and agreed that Andy should accompany the old
man north to ensure he did not overextend himself at the three-day
bash.

In the meantime Bixby was packing his bag, reviewing his set speech and
chafing in his eagerness to get started on a trip that would again
bring him into contact with fans and many of the great players who had
come along in the years since 1929.  Andy saw that the only thing that
might cause Buzz trouble would be his enthusiastic desire to do too
much, a fear that proved well founded in the days prior to departure
when one organization after another, upon learning that Bixby would be
attending the show, wanted to sign him up for an appearance at some
function, or an interview, or a short trip into New York City for one
of the morning talk shows.  Buzz wanted to do everything, and if any
phone call reached him directly, rather than through Dr.  Zorn's
office, he blithely said: "Sure, I'll be with you."  It was clear that
this was going to be a rather hectic affair.

On Thursday morning, four baseball enthusiasts from the Palms drove
Bixby and his caretaker to the Tampa airport, where Buzz actually ran
up the various ramps to reach the train that carried passengers to the
planes.  Settled into comfortable seats for the long flight to New
York, Buzz and Andy went over the proposed schedule of obligations for
Long Island, and the doctor was surprised to find that there were two
schedules, one that he had approved with considerable care, after
consultation with the managers of the convention, and one that Buzz had
agreed to in his informal phone conversations with anyone who happened
to call.  Since there was little similarity between the two, Andy saw
that accommodations would have to be made, giving priority to the
important meetings.  Buzz brushed such discussion aside: "We'll do 'em
all," and it was a standoff.

After settling into their motel, Andy and Buzz approached the immense
industrial shed, a place larger than a football field, where some
eighty card dealers had erected their stands.  The hall contained so
much clutter that Andy could scarcely see from one end to the other,
for almost anything that could reasonably be related to baseball seemed
to be for sale.

Pride of place, however, went to those stands whose occupants had
baseball cards for sale or trade.  There must have been four dozen big
stalls, and whenever Andy and Bixby passed one of them the owners,

who were busy arranging their goods for the opening the next day,
s guessed that the old man must be the immortal Buzz Bixby.  They
wanted Buzz's assurance that he would later autograph some of the
special cards they'd had printed up with his picture as he had appeared
in the 1929 game.  He said yes to everyone.

The managers of the affair had arranged a small dinner in Bixby's honor
on the evening before the opening, and at it he was at his best.

He had acquired through the years a taste for dark German beer,
although a Guinness stout would do as well, but with the
self-discipline that had kept him active in the big leagues for so
long, he restricted himself to one bottle a night.  He did not want it
served in a glass, for then the portion was apt to be smaller, and he
nursed along his bottle, never gulping it down but savoring each
carefully apportioned mouthful.

He was, Andy thought as that first evening progressed with Bixby
relating old adventures in the various ballparks of the 1920s and '30s,
as fine an example of a celebrated old-time professional athlete as one
could have hoped for.  Zorn realized that he now prized this old man
far more than he had when he first heard him reciting his famous
account of that historic game in Philadelphia.

Andy had to admit, however, that it was a strain on the three following
days to sit and listen to Buzz give his speech twice a day, afternoon
and evening.  There would be a roll of drums and Buzz, seated in a
comfortable chair with a glass of water at his side, would deliver the
familiar opening sentence in a warm, husky voice: "Some who are
entitled to have an opinion believe it was the greatest game in the
history of baseball, but I've seen better on television, Bobby
Thomson's one-out homer against Ralph Branca..  .."

Andy thought that each of the six times Buzz gave his oration it got
better, but that was improbable because the words and the delivery were
always identical.  These sessions were the biggest events of Buzz's
life, and he savored them.  But what surprised Andy was that when his
talks ended, Bixby had the energy to circulate among the dealers,
signing almost anything they placed before him: "Buzz Bixby, 12 October
1929."

Bixby, with his enormous popularity as the oldest World Series player
ever to appear at such a function-'ninety years and still able to hit a
curve," the announcer said when introducing Bixby's speeches-had long
lines waiting whenever he took his scheduled place at a dealer's table,
and at seven bucks a throw for his autograph and the exchange of a few
words he would make far more during this visit than he had in the
entire year when he starred in the Series.

Andy was astounded at how much money was involved, and one of the Long
Island men informed him: "These grand old players earn much more money
each year from us than they ever did playing the game, when salaries
were so modest."

"Does something like this take place elsewhere in the country?"

"All the time.  Everywhere they can draw a crowd.  Most affairs feature
an old-timers' game.  You see the men in action again, but they play it
canny.  No one wants to pull a hamstring from running too hard, and
those who have to wear glasses play it very cautious at the plate."

It was a phenomenon unmatched in any other sport.  One of the managers
explained, "No football player can be idolized by the fans the way a
baseball player is.  He plays one hundred fifty-four games a year, old
style, one hundred sixty-three new style.  And he stays at it year
after year.  And most important of all, he usually does it for the same
team, ten, twenty years at a time.  The hometown fans grow to love him.
But you take football.  The players have so much gear on them that the
fans never really see them.  There's little identification and not much
love, they move around so much, one town after another, loyalty doesn't
have a chance to develop."

"What's going on over there?"  Andy asked, pointing to where a mob
surrounded a player.

"That's the real phenomenon.  Pete Rose.  Very stormy career, banned
from baseball for betting on the game, but a great hero.  The fans love
him, and Pete comes here with two truckloads of stuff.  He sells
everything.  The shirt he wore when he broke Ty Cobb's record, the bat
that got the base hit.  He sells them everywhere.  Or anything else you
might be interested in.  He earns a fortune at these affairs."

Later, Andy was amazed when Buzz, his speech finished and his signings
done, wanted most of all to visit with Pete Rose.  When the two stood
together for the photographers, Buzz acted out one of the memorable
scenes of World Series play, instructing the cameraman as he went:
"Game six of the World Series, Tuesday, October twenty-first, 1971,
Kansas City at bat in the ninth, bases full.  Critical moment.

Frank White batting for KC.  pops a high easy foul ball, which Phillies
catcher Boons ought to catch with no trouble, but the ball pops out of
his mitt, giving White another chance to win the game.

"But wait!  Pete Rose far away at first base anticipates that his
catcher might have trouble with the ball, so what does he do?  He
gallops full speed to where he guessed the catcher is going to wind up,
and sure enough, when the catcher allows the foul ball to bounce out of
his glove, there is Pete ready to dive for it like this!"  And to
Andy's amazement the ninety-year-old man leaped forward, fell onto his
knees, and with outstretched left hand pretended to catch the errant
foul ball, a few inches off the floor of the hall, just as Pete Rose
had done nearly a quarter of a century before: "I revere Rose for that
supreme effort, mark of a true champion."

Late Sunday night, at the close of the three-day festival, the Long
Island card dealers had a small dinner to express their gratitude for
Bixby's participation in their festival.  He had one bottle of dark
German beer, a small steak rare and a large wedge of pecan pie.  In
response to the speeches the managers made in his honor, he replied
with his own set speech: "And so we see that we are the toys of fate.
Chance determines so much of our lives, as my case proves.  I keep with
me photographs of my two hits in the wild inning.  They show Hornsby
missing my grounder by less than an inch and my pop fly, same margin.

An inch and a half in his favor, I'm a bum.  An inch and a half my way,
I'm in the Hall of Fame.  Chance does direct all."

At midnight, as the taxi drove them back to their motel, Buzz leaned
over, patted Dr.  Zorn on the hand and said: "I'm so glad you allowed
me to come.  And thanks for seeing me get here safe.  I'd never have
been able to do it alone."  He then squeezed the doctor's hand and said
with childish joy: "They remembered me.  They lined up to get my
autograph as if they knew who I was.  I earned so much money doing what
I enjoy doing."  And he trundled off to bed happily.

Andy had barely fallen asleep when he heard a knock at his door.  It
was Buzz, who had found himself with a bad conscience when he reached
his own room.  At first he had decided he could wait and clear the
matter with Dr.  Zorn in the morning, but the more he worried about the
impression he might have left, the more he knew he ought to explain
right now.  Hence the knocking on the door.

Andy climbed back into bed, invited Buzz to take the chair nearby and
listened as the old ball player unburdened himself: "I don't want you
to misunderstand the way I treated Pete Rose.  I love that man.  He was
always my kind of man on the field.  Fight all the way.  Don't
surrender to nobody."

"Why are you saying this?  You treated him fine when you saw him."

"I'm talking about another time-when the time came for Pete to be voted
into the Hall of Fame, they wrote letters to guys like me who were
already in.  Would it be right for them to elect Pete, him being a
lawbreaker?"  He stopped, obviously pained by his remembrance of that
difficult decision, and Zorn waited for him to continue: "I argued with
myself a long time.  Finally voted against him.  Yes, I voted against
the same man you saw me with a few hours back."

When Andy asked "Why?"  Buzz explained: "Maybe you don't understand
baseball, Dr.  Zorn, but for the manager of a team to bet on games,
that's way wrong."

"I thought it was established that Mr.  Rose had never bet against his
own team.  Pittsburgh, wasn't it?"

"Cincinnati.  You see, a manager can control all angles of the game.

Pitching rotation especially.  He knows who he's going to pitch the
next day and the day after that and right on down the line.  Good
pitcher, twenty-game winner, this day.  Poor one the next day, against
a poor team.  He has to let the gamblers know when he's betting, when
he's not, and word can spread.

"Rose is laying off the Friday game," or "Pete is betting a bundle to
win on Thursday."  It messes up the whole system."  He sat silent for
some moments, then said with a deep sigh:

"Poor Pete.  I'm sure he never bet against his own team.  But he'd
worked himself into a hole he couldn't climb out of.  So I had to vote
against him."

That must have been painful."

"Worse.  It was confusing.  Because Pete Rose is on my personal
all-time team.  I love that guy, but my team is a personal thing.  When
I had to think of putting him on baseball's Hall of Fame team, the one
that stands for the game itself, I just couldn't do it.  I can stomach
Pete Rose.  The game couldn't."  And this time he left the room for
good.

As Zorn heard him go down the hall, a deeply worried man, he thought:
How strange!  No one in this life avoids facing up to moral problems.
Half the discussions in the tertulia deal with profound questions of
right and wrong.  Who would have thought that quiet Buzz Bixby,
interested only in baseball, could have been wrestling with a problem
worthy of Immanuel Kant: "Who in this world is the righteous man?"
Reflecting on his own moral dilemmas, he did not fall asleep for some
time.

When the time came on Monday for Dr.  Zorn to shepherd the old man back
to Florida, he found to his surprise that Buzz was uncharacteristically
late.  He received no answer to his call to the room, so he supposed
that Buzz was on his way, but when he did not appear Andy grew
suspicious and asked the motel people to check.  Buzz had died
peacefully in his sleep, not drunk with German beer but blissfully
intoxicated with the affection that had been shown him by the fans on
Long Island, not one of whom had ever seen him play.

The next morning on his flight back to the Palms, when Dr.  Zorn
glanced at his New York Times and came upon the obituary page, he found
an answer to the question that had been posed by the men of the
tertulia: Of all the people at the Palms, whose obituary would be given
the most prominence in the press?

There it was-two full columns on the death at age ninety of Buzz Bixby,
the famous baseball player of the 1929 Athletics, who in the World
Series of that year drove in four and scored two of the ten runs in
that historic seventh inning.

For some weeks after their experience with the death of the basketball
star Jaqmeel Reed, Dr.  Zorn and Nurse Varney avoided comment on that
tragedy or on the continuing plague of AIDS because the topic was too
painful for both of them.  But there was another deterrent, and perhaps
it was the more potent: as medical personnel both the doctor and his
nurse realized that they ought somehow to be engaged in combating the
rapid spread of the disease and they were ashamed that they were
remaining on the sidelines while the enemy was being fought by others
like the Angelottis with their hospice and Dr.  Leitonen with his
personal mission to the doomed.

And then, one day when Nora was giving Dr.  Zorn a routine update on
Health, she suddenly slumped in her chair, and said in a voice heavy
with sorrow: "I feel guilty."

"About what?"

"Leaving Jaqmeel to die alone-by himself."

"Nora!  I was there to comfort him.  So was Dr.  Leitonen.  And Pablo,
of course, was there to help."

The black woman shivered, lowered her head and whispered: "That's what
I mean.  When you and the other two weren't around, Jaqmeel told me:
"You've got to stay with me.  I don't want to die surrounded by white
men in rubber gloves."  She paused, then said bitterly:

That's how they all die.  With no human touch."  Struggling to compose
herself, she said: "We turn our backs on them.  Me most of all, because
I was needed."

"Nora, Dr.  Leitonen fled, too.  Couldn't risk being seen in company
with Pablo at the end.  As a licensed nurse, maybe you did the right
thing, too-the prudent thing."

"But I was his aunt.  I was family."

Zorn rose from his desk and strode about his office, trying to sort out
his thoughts about this plague, which had so overwhelmed and confused
the medical profession.  Like many other doctors across the nation, he
felt totally adrift.

"We start with one fact, Nora.  You're the ablest health officer in the
Palms.  Far ahead of the other nurses, and way ahead of me.  You're the
comforter, the stable resource, and the strong woman we turn to in time
of trouble."  He stopped by her chair and pressed one arm around her
shoulder: "That's how we see you, Nora, so don't castigate yourself."

"Yes, I can comfort everyone except my dying nephew.  That was too
cruel for me to take.  So I abandoned him.  White men with rubber
gloves, ending his life for him."  She collapsed into racking sobs, her
head still on the desk: "He was the hope of our family, that boy, and I
deserted him."

"So did his parents," Zorn said.

"So did his coaches."

"But they didn't know any better," Nora mumbled.

"I'm a nurse.  It's my job to know."

Zorn corrected her: "But do any of us know?  Apart from people like
Leitonen and Pablo, how many of us have been willing to deal with this
dreadful scourge?  I'm as confused as you are, Nora.  I'm a medical
doctor and this is a medical crisis.  I ought to be in the front lines,
but

I quit my practice because of the despicable things they did to me and
now I'm outside the battleground and it gnaws at me."

She reminded him that he had brought vitality to the Palms and had
affected almost every life there for the better: "You don't need to
apologize to nobody, Dr.  Zorn."

"But when you took me to see Jaqmeel that first day, in that hovel, you
took me into the heart of the hell that is AIDS, and I've been uneasy
ever since.  I feel as if I had betrayed my chosen profession, lost the
ideals I had as a boy.

"But I don't want you to grieve, Nora.  Too many people depend on
you."

When Nora was about to leave, she paused at the door, looked back at
Dr.  Zorn slouched over his desk and said: "The comforting things we
say to each other, Andy, they don't erase the fact that I escaped down
those dark stairs when Jaqmeel was about to die.  The echo of those
steps I took won't ever go away."

They did not speak again about AIDS until one morning when Andy
abruptly said to Nora: "I've been thinking about that kind woman with
the Italian name, the one who runs the hospice," and Nora said: "Mrs.
Angelotti-yes I've been thinking of her too, and about the hospice and
Dr.  Leitonen."

"I think we ought to see what's happening at the Angelottis."  She
agreed and they drove to the house where her nephew had died."

"What brings you here?"  the Angelottis asked.

"Don't say you have another patient for us."  Nora answered first: "I
wanted to thank you for the way you eased things for my nephew.  You
made the passage tolerable."  Then she looked at Zorn and said: "Him? I
don't know why he wanted to come," and Andy said with obvious
embarrassment as he took an envelope from his pocket and handed it to
Mr.  Angelotti: "I wanted to help you keep this refuge going.  It's
really needed."  Then he said to Mrs.  Angelotti: "And I wanted to tell
you that if you have any young men with ordinary diseases who need
medical care, not in the dying stages because I can't help there, but-'
He was aghast at the terrible distinction he was making and did not
know how to make himself understood.  In a rush of words he said: "You
know what I mean.  A young man who has, let us say-' Again he could not
finish, so Mrs.

Angelotti helped him: "Yes, I do know.  Those men in the game room, the
ones who won't be dying for some months.  They too need help.  Block
the kidney disease, they have a chance of living six more months."

"I suppose you know I'm not certified to practice medicine in Florida-'
"Who among us is?  That's why Leitonen is such an angel in our eyes.

He has certification and he risks it every day."

"But I could give you advice," Andy said.

"If you have a question, I could help you work it out."

"And how would we get in touch with you?"

He spent some moments considering this crucial question.  They must not
call the Palms, for that might endanger the retirement area's
licensing.  Nora came to his assistance: "You could call me, Mrs.
Angelotti," but Zorn protested: "No, they'd know you were at the Palms,
and the damage-' "I'm aware of that," Nora said.

"You can call me at home," and she gave the Angelottis her number,
adding: "And if you need special nursing care, call the same number."

Mrs.  Angelotti turned to Dr.  Zorn and asked: "So if I have young men
with associated medical problems, I can telephone you through Nora, and
you'll come and help them."

Carefully weighing the implications if he agreed to provide that
service, he said: "Yes, I'll help," and with that decision he was drawn
back into the medical profession at one of its most critical crises.

One morning Laura Oliphant on the ground floor had cooked her own
breakfast, and while eating her toast she bit down so hard on an edge
of rye crust that she loosened a small porcelain facing on a dental
bridge.  With her next bite the facing fell off into her mouth.

She was irritated, but in no way distressed, because with dentures such
accidents were to be expected.  A brief trip to a dentist would solve
the problem quickly-perhaps fifteen minutes for the epoxy to harden and
no harm done.

But her teeth were in such good condition that she had not established
contact with any local dentists.  So she went to the main office to
consult with her trusted friend Nurse Varney, and when the black woman
learned what the problem was, she laughed: "Not to worry.

Any dentists we use will be able to handle this with ease."

"Do I have to go all the way to a dentist?  Can't someone-' "Miz
Oliphant, in Florida we have a law which says that with any tooth
problem you have to see a licensed dentist."

"Even for gluing back on?"

"Especially for gluing back on.  A young man in my neighborhood, he's
one of the best dental mechanics in Tampa.  He could fix your bridge in
ten minutes, three dollars."

"Will you take me to see him?"

"No, no!  If there's even one dental piece in that boy's shop without a
proper signed order from a licensed dentist, that young fellow is in
trouble."

"So I have to go to a dentist?"

"Yes."

"How much will it cost, do you think?"

"We have one dentist in town north of here, Velenius, twenty-five
dollars."

So Ms.  Oliphant was driven a few miles north to the pleasant suburban
town of Royal Glade, where Dr.  Velenius, an engaging young man with a
neat, clean office, glued the porcelain facing back on, buffed it with
a bit of pumice, inspected her other teeth, knocked away some plaque,
buffed the other teeth and charged her three hundred and twenty five
dollars, which she paid by check.

When she returned to the Palms she went to Mrs.  Varney's office and
said: "Your Dr.  Velenius was good, but very expensive."

"How much?"

"Three hundred and twenty-five dollars."

The nurse gasped, asked her to repeat, then asked: "But surely he did a
lot of extra work besides the facing?"

"He poked around a bit.  Did some polishing, with a buzzer."

"How long?"

"Fifteen minutes."

Mrs.  Varney was so outraged by this gross overcharging that she took
the matter to Dr.  Zorn, and when he heard the charge for a routine
service that should have cost no more than a hundred dollars at the
most, he pushed both palms against his desktop and stood up, saying:
That's it.  Did you tell me some time ago that a young man in your
building-' "Yes.  He's a dental mechanic."

"Technician, they call such men."

"He calls himself a mechanic."

"Let's go see him."

"Wait a minute, Dr.  Zorn.  I don't want you to put him in any
trouble."

"No fear.  I can guess what pressures he's already under."  When Andy
and his nurse went to the black part of Tampa and entered a small,
well-arranged laboratory equipped with obviously expensive machines for
forming and hardening first the metal structures that are the core of a
denture and other materials for forming and backing the enamels that
are glued on to make the denture, Andy found the young fellow to be
knowledgeable about all aspects of his highly technical profession.

"I'd like to ask you some questions, so that I can help our residents
better."

"I can't sell you anything, you know.  Or fix anything."

"Mrs.  Varney explained that.  But as the head of a retirement center
I'd still like to ask a few questions."

"Shoot."

"Is it true that you can work on any dental object only if it comes to
you from a dentist licensed to practice in Florida?"

"Right."

"And permission must come in the form of a written prescription?"

"Look at the things on that table," and when Andy did, he saw that each
denture had attached to it by rubber band a clearly written
prescription from an authorized dentist.

"And if I tried to slip you a denture to have a fallen porcelain facing
glued back on-?"

"I could lose my license."

"What would it cost me if I could have you glue my facing back on?"

Three dollars, and two would be my profit."

"What would you say if I told you that one of our women residents at
the Palms was charged three hundred and twenty-five dollars?"

U' i

The technician said nothing, just lowered his head.  A statement
like the one Andy had just made summarized so accurately the problems
of medical care not only in Florida but also throughout the United
States that he could only shake his head in disgust.  The honest
workmen like himself getting pennies for performing an honest task,
while the fancy operators earned hundreds of thousands.  It was unfair
and embittering.

"Who was this robber?"

"No," Zorn protested.

"I didn't come here to complain about individuals.  The system is what
infuriates me."

"Velenius," the nurse blurted out.

"I sent her there."

The young man shook his head sorrowfully: "He's a good man.  He gives
me a lot of work," and he waved his right arm toward a bench containing
three or four Velenius prescriptions.

"He's really a fine dentist.  He doesn't need to play tricks like that.
I'm astonished."

When Zorn deposited Nora at the Palms, he impetuously decided to double
back and confront Dr.  Velenius to see if Ms.  Oliphant's bill could be
adjusted.  He drove north along a tree-lined road that led him to the
pleasant village of Royal Glade, where he had no difficulty in finding
the offices of Dr.  Mark Velenius.

Since the dentist was busy with a patient, Andy occupied himself with
magazines taken from a hand-carved rack containing at least two dozen
journals.  He picked a Scientific American, which carried a technical
account of recent developments in solving the Alzheimer's mystery and
he became so deeply engaged in details about Chromosomes 21,19 and 14
that he did not hear when the nurse at the telephone said: "Dr.
Velenius can see you now, Dr.  Zorn."

"Did you call my name?"

"Yes.  The doctor's waiting."

Andy entered a spacious room containing three different dental machines
and decorated with expensively framed prints of Monet, Renoir and
Pissarro.  A muted sound system was playing Chopin.

"I'm told you're the able new manager out at the Palms, one of the best
retirement operations in Florida."

"I work at it.  And we do try to make improvements."  He hesitated,
looked at the three paintings and said: "I see you too try to keep up
to speed."

"Yes, if some of my patients find a visit to that chair unpleasant, the
least I can do is make the other surroundings agreeable.  Chopin, do
you cotton to him?"

"Like you, I find piano music soothing and delightful."

"Now, what can I do for you?"

Zorn hesitated a moment, then looked straight at Velenius and said:

"Could we talk about the bill that one of our residents, Ms.  Oliphant,
received this morning?"

Dr.  Velenius did not flinch: "Oliphant?  Was she that elderly woman
with the broken plate?"

Andy noticed that the dentist had established right at the start that
Ms.  Oliphant was elderly and therefore in a special group: "Yes, she
is elderly but in no way confused or unable to make her own
decisions."

"Not at all!  I remember her as well keyed in.  Knew what she
wanted."

"Her plate was not broken, Dr.  Velenius.  A porcelain facing had
fallen off."

"We classify all accidents as breaks.  Emergencies.  Sometimes
catastrophes."

"I've asked around, and they tell me it costs about three dollars to
replace a facing.  One dollar for materials, two for time and knowing
the proper materials."

Velenius smiled, stood very straight and said: "I suppose you could say
that about almost any human endeavor.  Cost of materials three cents,
cost of the accumulated wisdom and skill, three hundred dollars."

"But you charged her three hundred and twenty-five dollars."

Velenius betrayed neither surprise nor alarm: "Not excessive for all I
did."

"For example?"

"Dr.  Zorn.  I understand that you do not actually practice medicine?

That you're not licensed in Florida?  That you're serving as managerial
director at the Palms?"

"Accurate in each detail."

"I should think that you might be hesitant about inquiring into the
practices of those of us who are licensed to work in Florida.  You
might, upon reflection, reconsider, and judge yourself to be just a bit
out of bounds."

"Yes, I would if I presumed to criticize your dental skills or the
medical work you did on one of my residents.  But when an elderly
woman, as you accurately describe her, is most grievously overcharged
for a mere gluing on of a facing-' "You're forgetting the adjusting to
make the new face fit accurately with the lower teeth, the careful
checking of the overall bite, the probing to see if the gums are still
firm, the half-dozen other things a careful dentist does."

"You think it justified a three-hundred-and-twenty-five-dollar
charge?"

Velenius rose and moved toward the door, where he waited stiffly:

"Dr.  Zorn, it ill behooves a man who practically lost his license in
Chicago for near malpractice to come here to Florida and lecture real
professionals who are performing their duties in proper fashion.  This
interview is ended."

"Not quite.  You preyed upon an elderly woman on the assumption that
she would soon be gone anyway, and that you might as well grab her
money as allow someone else to get it."

Now Velenius flushed, and only with steely control did he refrain from
punching Zorn.  Velenius would never admit, even to himself, that he
felt free to charge wealthy old people whatever he could get from them,
but that was the way he practiced, and he knew it.  To hear an upstart
who had fled a shady reputation in Chicago-local medical circles had
been gossiping about Zorn since New Year's, when he arrived-was
intolerable.  So after practically throwing Zorn out of his office, the
young dentist dictated a long memorandum to his secretary regarding the
unprofessional behavior of Dr.  Andy Zorn of the Palms, a physician
unlicensed in Florida, who had fled malpractice accusations in
Illinois.

While Dr.  Zorn was dealing with a multitude of managerial matters the
most critical being the threat posed by Hasslebrook, the burial of Buzz
Bixby and a possible fallout after the quarrel with the dentist, he was
also surrendering his authority to move Betsy Cawthorn out of the
Palms.  She refused to go, and her obstinacy was supported by Andy's
closest associates.  Quietly, one by one, Miss Foxworth, Ken Krenek and
Nora advised him against a decision he had announced without adequate
study.

But the most surprising veto came from Betsy's father, who wrote from
Chattanooga:

Dear Andy, I was flabbergasted when Betsy told me over the phone that
you had decided it was time for her to leave your place and come back
to Chattanooga.  This is dreadfully wrong advice and I hope you will
not act upon it.

You cannot appreciate Betsy's condition when she was up here.  I
suspect she was actually close to death, either from wasting away or by
her own hand.  You and Yancey saved her, and just in time.

Zembright and I judge she needs at least another year with you and
Yancey.  Her condition when I last saw her in your place was what it
ought to be, and I fear that if she came back here without your
support, she might wither.  Please reconsider.

Oliver Cawthorn When Andy was forced to acknowledge that his order to
send Betsy home could not be enforced, he faced a curious emotional
dilemma.

On the one hand he felt some irritation because she had outmaneuvered
him.  And this kept him from being generous in his relations with her,
for he now saw her as aggressive, willful and devious, all of which,
because of her deep attachment to him, she was.

On the other hand, when Yancey kept inviting him to join Betsy at
tennis, he leaped enthusiastically at the suggestion, as if there were
perfect harmony between them.  Dressed for the game in new twill shorts
and a chic polo shirt bearing the logo of a famous French tennis star
of decades back, he had to admit, when he looked at himself in a
mirror, that he was quite presentable-perhaps even attractive.

Whenever he appeared on the court both Yanceys and Betsy greeted him
with warmth, and as he stood beside Betsy every resident who passed the
court stopped to give encouragement and voice their approval

"You make a handsome couple out there' was the most common remark, but
others commented on how vastly improved Betsy was_ "Soon you'll be able
to drop the cane' was Mr.  Mallory's prediction.

It was Ella Yancey, however, who made the most telling remark, for
sitting on the sidelines as the others rallied she said: "You really
look like the perfect doubles pair."  Long after the tennis sessions
were over, Zorn heard this echoing in his brain, adding to the
cacophony of his conflicting thoughts about Betsy.

The only person at the Palms who was aware of the waiting game that
Betsy was playing was Nurse Nora because of her motherly interest.

Miss Foxworth saw Betsy as a renter of one of the expensive apartments.
Ken Krenek saw her as a young woman who needed additional
rehabilitation in Florida's salubrious climate.  The Yanceys saw her as
a stubborn but courageous young person whose father was prepared to pay
them additional funds to cater to her wishes.

But Nora, watching the two young people shadowboxing like fighters
afraid to make significant moves in an important fight, grew impatient
with what she properly called 'their stupidity," so she waited for an
opportunity to make a move of her own.  Finding Andy alone in his
office one day, she went in, sat on the edge of his desk and asked
boldly, "Wouldn't it be good for our girl Betsy if you-' "She's not a
girl, Nora.  She's a grown woman."

"That makes my question even more appropriate.  Wouldn't it be a good
thing to do to invite her to lunch and maybe a movie?"

"Not a bad idea to help her gain confidence.  Why don't you take the
afternoon off and give her a whirl?"

"Andy!  You don't get it!  Now that it's clear she's going to spend a
while longer with us, you ought to take her out to show her there are
no hard feelings."

"Do you think so?"

"I don't think it, I know it.  You take the afternoon off."

"I'm not so sure.  Things haven't been .. . well, totally comfortable
between us recently."

"But she is here, and she deserves decent treatment.  Now, pick up the
phone while I watch, and make the call."

Fortunately Betsy was in her apartment.  With some hesitancy Andy said:
"Nora has just pointed out that I have no appointments this afternoon,
and I wondered if you might be free to have lunch with me at some
restaurant near here."

Betsy, unsuccessfully trying to mask the joy with which she heard this
invitation, said: "Doctor, that would be delightful, where?"

"I haven't a clue-but I was thinking of someplace small where we could
talk."

She was careful about presenting him with options because she felt it
was important that he make the decision: "There's some great Chinese
food in these parts, but they tell me Vietnamese is lighter and
tastier.

There's a German restaurant that's supposed to be first-class, but the
food is too heavy if you want to play tennis later."  Then she said:
"My bridge partners tell me that a small place, not pretentious at all,
the Captain's Table, has great seafood."

"Let's give it a try," he said enthusiastically and they drove to a
Tampa waterfront bistro.  The walls of its three rather small rooms
were adorned with deep-sea fishing gear such as oars and nets and
pilot's wheels, but the dominant features were the taxidermist's
treatment of swordfish, dolphins and, in the room Betsy had chosen, a
huge shark with a monstrous jaw filled, it seemed, with two extra sets
of lethal teeth.

They ordered the house noontime special, a bowl of Louisiana gumbo, a
platter consisting of three kinds of broiled fish and a baked potato in
its crisp jacket.  Each table was decorated with bottles of condiments
ranging from a blistering hot sauce prepared from peppers to a mild
Worcestershire-style mix imported from England.  It was a Lucullan
feast.

"What's this?"  Andy asked the waitress about an unusual side dish and
she said: "Dirty rice."

"What's in it besides this discolored rice?"  and she explained:

"Chicken giblets, maybe a touch of crab meat, maybe pieces offish, and
broth.  It's big in New Orleans."

"Delicious."

"And for dessert you get a piece of Key lime pie."

As he polished off this extremely tasty lunch, Andy said: "If the
German lunch is any heavier than this, God help the Krauts," and Betsy
replied with a twinkle in her eye: "You didn't have to eat it all.

Anyway, at your weight you can afford a big meal now and then,
especially with all the tennis you're playing."

As she said this she noticed that because their banquette was rather
narrow his right hand was close to hers on the table, so without being
in any way aggressive or forward, she allowed her hand to rest near
his, and as they leaned back to sip their coffee, their hands met and
each felt an electric thrill.  Looking straight ahead, Betsy used her
free hand to trace tiny grooves in the wonderful oaken tabletop,
decades old and scrubbed so often that the softer wood between the
ridges had worn away, leaving an almost satiny surface.

"This is quite beautiful," she said, but her full attention was riveted
on their hands.

As they started to leave the restaurant they saw on the wall near the
cash register a poster from one of the Tampa movie theaters announcing
a special showing of an Anthony Hopkins film, and she cried
spontaneously and with no ulterior purpose: "I hear that's a marvelous
movie.  He's such a strong actor, always full of surprises."  Andy said
quickly: "Let's go," and they drove to the movie.

As the story unfolded on the screen, with Hopkins at his controlled
best, their hands met again and remained clasped throughout the show.

In the days that followed, it was now Andy who proposed to Betsy and
Yancey that they have a brief rally on the tennis court, and he
invariably paired with Betsy, who each day became more attractive to
him.

Two weeks later he surprised her by suggesting that they return to the
Captain's Table for dinner, and as they sat on the banquette they had
used previously with a great shark staring down at them, he said
quietly: "I like this place.  I catch myself visualizing it as I work,
as if it were our restaurant."  And that evening they also returned to
the movies and held hands throughout the show.  When he brought her
home and walked with her through the corridors to her apartment, she
lingered at the door as if the evening were not yet completed, and
gently he moved toward her, took her by the hand and drew her to him
for a good-night kiss.

As he walked slowly back to his own quarters he thought: I'm behaving
like a fourteen-year-old schoolboy.  Well, I have problems a teenager
doesn't have.  I'm still tormented by the ghosts of the past.

But he did manage to take the first big step.  With a painful effort,
he succeeded in burying forever the ghost of Ted Reichert, that pitiful
young doctor he'd had to fire from his clinic.  The memory of him had
tortured Andy in his relations with Betsy Cawthorn.  But now he
realized: "Reichert and me, there's no comparison between us!  He was
an arrogant fool.  I'm not.  He played one-night stands.  I don't." And
the fear was exorcised for good.

For the first time he began seriously to consider the possibility of a
life with Betsy: "I'm only twelve years older, and there are lots of
couples in Gateways who have that big a difference or bigger."  When he
reached his quarters he went into the bathroom, stood before the mirror
and assessed himself.  After combing his hair and sucking in his
stomach, he concluded that he was still eligible, and that twelve years
was not so daunting.

Once Mr.  Hasslebrook's true identity had been exposed, the
representative of Life Is Sacred became an important fixture in the
Palms.  Setting up a kind of office in his Gateways room, he became
both the critic of how the retirement area operated and the self
appointed defender of the patients' right to live.  He kept on the
table in his room copies not only of the literature put out by Life Is
Sacred, pamphlets against euthanasia, but also those of sister
organizations that were opposed to abortion.  He himself rarely
mentioned the crusade to protect the unborn, feeling that his primary
obligation was difficult enough to require his full energy.

When Dr.  Zorn and Krenek tried to stop him from haunting the third
floor of the health-services building, they learned that he had
acquired semi legal status as an amicus curiae, friend of the court,
who policed nursing homes to ensure no one was committing euthanasia.

As he visited the bedridden people in the hospice, he assured everyone
that he was there to guarantee that they would receive good care and be
protected from anyone who might want to shorten their lives: "I am here
to do God's work and to ensure that you are treated according to
Christian principles.  I am your friend, and you may call on me for

guidance at any time."  His manner was grave but reassuring, and he
gave many a feeling that in the confusing world of the hospice they had
a friend they could trust.

If someone like Mrs.  Umlauf had signed a living will that would
legally empower the doctors to terminate a life that no longer had any
meaning, he did not try to persuade the patient to revoke that
decision.

He offered to pray with patients so inclined in the hope that their
sentient life would be prolonged and promised to do what he could to
help them avoid slipping into a life-ending coma.  As to Mrs. Carlson's
protracted dying he insisted that it was the procedure that God had
ordained.  He kept close watch on the doctors and nurses and he was
pleased that Mrs.  Umlauf stopped her visits to Mrs.  Carlson's room.

She had told the office: "I cannot abide what's happening to Mrs.

Carlson.  It's inhuman, un-Christian and probably against the law." She
was assured that she was 100 percent wrong.  It was in strict
conformance to Florida law and Mr.  Hasslebrook was in effect an agent
of that law.

For some weeks the members of the tertulia observed Mr.  Hasslebrook
from a distance, perplexed by what they were seeing and especially
hearing.  Some residents thought him a godsend because of his concern
about their welfare, others considered him an unconscionable busybody.
This difference of opinion piqued the curiosity of the tertulia and
Raul Jimenez proposed inviting Hasslebrook to dine with them one night.
President Armitage opposed the idea: "I talked with him at length one
night, or tried to.

Found him a total bore, a Yes-No man without an idea.  I judged he had
made a mistake in coming to a place like this."  Jimenez argued: "But
if he's an agent of the Life Is Sacred group he must have something to
say, and I'd like to hear it."

So the invitation was extended, and the men, who had heard of his
taciturnity and lack of ideas, were surprised to encounter an entirely
different kind of person.  He spoke not only with vigor but also with a
considerable command of the language.  He was, in fact, loquacious:

"Graduated from Holy Cross, but I'm not a Catholic.  My wife died some
years ago.  Left six children, all properly launched.  I was a member,
but not a partner, of a good law firm in Boston.  I was casting about
for something of significance to apply myself to, and I discovered Life
Is Sacred.  I suppose the loss of my wife had made me brood about such
things."

"What principles does it espouse?"  Ambassador St.  Pres asked, and he
explained, The name tells it all.  At the moment of conception human
life becomes the most precious commodity on earth.  I don't get too
involved in the abortion crisis; there are a lot of good Christians
working on that.  I'm concerned about the orderly, Christian miracle of
death, the ending of a sacred life."

"I understand," Senator Raborn said, 'that you're opposed to
euthanasia."

"A horrible word.  A horrible act.  I am committed to fighting it in
every way.  That's why I'm here.  Our group slips people into
organizations like this that are running hospices, where terrible
things go on.  The perpetrators have to be exposed and condemned and
sent to jail if they persist in committing murder."

"You term it murder?"  Raborn asked, and Hasslebrook started to reply
at length: "I suppose you men could be classified as typical East Coast
liberals'-but Jimenez cut him short: "I'm a Roman Catholic
conservative, like your former wife, probably, and I am strongly
opposed to euthanasia.  I too consider it murder."

Rebuked, Hasslebrook apologized, then continued with his set speech:
"Men who do my type of work, protecting the aged, serving as friends of
the court to see that the laws are observed, have been much influenced
by the lessons of Hitler's Germany.  The Nazis started killing the
Jews, whom they called an unclean race.  Then it was the Gypsies.  Then
they killed the Poles, an inferior race.  And the homosexuals, deviates
from the norm.  And the physically handicapped.  And in the prison
camps they planned the steady extermination of the aged because they
were too old to contribute much any longer.  Gentlemen, when you start
down that fatal road you wind up, inescapably, killing everyone who is
not like yourself.  Mark my words, if Hitler had invaded some nation
with a big black population, he would have had to exterminate them,
too.  And one still wonders how his pure-race Germans could ever have
cooperated in harmony with the yellow-race Japanese.  Sooner or later-'
President Armitage, who had been disgusted with Hasslebrook when the
man first appeared at the Palms, was now intrigued by the thoughtful
logic behind his rejection of euthanasia.

"Explain to me, Mr.  Hasslebrook, how your logic leads you to such
strong conclusions about orderly death?"

"As direct as a bolt of lightning on a clear day.  Once the law gives
you license to exterminate life at either extremity-the unborn or the
elderly-soon you will justify writing your own rules for doing it at
any midway point.  You begin by advising the pregnant woman that she
can abort her baby because she has a fifty percent chance of having a
Down's syndrome child.  That settled, you can later get rid of your
unpleasant aunt because she's so tedious.  And of course your
grandmother because she is such an unproductive burden-she must go. And
finally you shoot your wife because she is in considerable pain, and
you can't stand to see her suffer.  It isn't that she can't stand it.

You can't, so you murder her.  The word is murder, gentlemen, and don't
try to mask it with Greek words and unusual spellings."

He delivered these last words with such force that for some moments the
tertulia was silent, a phenomenon in itself, but then Armitage, as the
humanist, asked: "And you are satisfied that you have the right to
dictate how the rest of us must end our lives.  Who gives you that
commission?"

"Who gave anyone the right to say, in 1933: "Adolf Hitler, to kill a
man simply because he is a Jew is a crime.  And if you persist, society
will have to hang you."  Nobody was ordained to say that, but somebody
should have.  Same today.  I have no moral sanction for what I do, only
my share of the human experience.  That ordains me, makes me a priest
of the highest order."

Raborn asked almost insultingly: "Do you ever think of yourself as a
fanatic?"

Hasslebrook smiled at him: "No, I'm not going down the Goldwater route:
"Extremism in the defense of liberty is no vice."  If I were a fanatic
I would do damage and should be condemned.  But when society is heading
down paths that are perilously wrong, somebody had better shout a
warning."

"And you think any form of euthanasia is perilously wrong?"  Raborn
persisted, and Hasslebrook snapped back: "I do."  Raborn, wishing to
nail down exactly how far the stranger would go in combating existing
law, asked: "How many of us at this table have executed living wills
and distributed copies to our families and close friends?"

Before the men could respond, Jimenez saw Dr.  Zorn entering the dining
room on an inspection and called out: "Zorn!  Over here!  Have dessert
with us.  A most fascinating discussion," and a sixth chair was drawn
up.

Hasslebrook and Andy sat facing each other, and Armitage, always
observant, sensed there was bad blood between them.  Obviously the
doctor considered the newcomer a spy intending to damage the Palms, and
Hasslebrook was aware that in trying to monitor conduct in Extended
Care he must inevitably cross swords with Zorn.

Jimenez was explaining: "Mr.  Hasslebrook has told us he's vigorously
opposed to euthanasia, and Senator Raborn has asked for a show of
hands.  How many have executed a living will permitting our lives to be
ended by either wise doctors or trusted friends?

Hands, please."  Jimenez and St.  Pres sat immobile, but Raborn,
Armitage and Zorn raised their hands.

"I'm surprised-' Hasslebrook began, but chose not to continue.

"What were you going to say?"  Armitage prodded.

"You were looking at Dr.  Zorn."

Reluctantly Hasslebrook said: "I was surprised that Dr.  Zorn, who
operates a hospice-' "We do not use that word," Andy said edgily.

"But that's what it is, whatever you call it.  I'm surprised that he,
of all people, should sponsor the living-will concept.  Is not your
obligation on the third floor to keep people alive as long as possible?
Doesn't the law demand that?  Doesn't Christian charity demand it?"

Slowly and carefully, and cursing himself under his breath for having
allowed Jimenez to drag him into a discussion like this, Andy said: "In
Extended Care our doctors who come in to serve there, our permanent
nurses who supervise the place, and all our staff, including me, are
totally opposed to euthanasia-' "We weren't talking about that,"
Hasslebrook said abruptly.

"We're talking about living wills-invitations to commit murder."

"Oh, wait a minute!"  Senator Raborn exploded.

"I abdicate none of my right of decision to anyone else to end my life.
But when I'm non compos mentis, a vegetable-' "Do not use that stupid,
pejorative word to describe a human being in a temporary coma-' "But if
it's final and fatal, it can't be described as temporary."

"Gentlemen!"  Jimenez said.

"We're having a discussion, not an alley fight.  The question before
us, if I remember correctly, is: How can

Andy Zorn, as a medical doctor obligated to support human life whatever
the conditions, justify having executed a living will?  Well, Zorn?"

Grudgingly Andy said: "As the man in charge of Extended Care I am
totally committed to preserving life to the last possible moment.  As
an ordinary human being concerned about my own welfare, I do not want
to be kept alive by the latest heroic measure invented last week by
some ambitious medic."

"No man with those ideas is qualified to manage an institution that
stresses health care, including a hospice," said Hasslebrook.

"If he has character and commitment, he is," said Armitage, and the
confrontation ended because St.  Pres said in a conciliatory tone: "Now
let's get back to Senator Rabora's question, which started this
debate:

"How many of us have living wills?"  ' Jimenez spoke up: "I'll answer
first.  I don't, because I'm a good Catholic, and our Church has harsh
rules.  No suicide can be buried in consecrated ground."

"Do you consider a living will synonymous with suicide?"  Raborn asked,
and Jimenez said: "The Church does and that's good enough for me."

"And you?"  Raborn asked the ambassador, who said: "I've enjoyed the
wild fluctuations of life so much that I want to be present to see the
end, however it comes."

"But if you lie there unconscious?"  Raborn asked.

"What kind of ending would that be?"

"I choose to think that even though I might look unconscious, that I'd
be clever enough to catch some signals of what was going on.  I'd still
be in the great game.  That's reward enough.  I'll sign no will
allowing some referee I don't know to blow the final whistle.  I want
to be listening when the real whistle blows."

Raborn turned to Hasslebrook and asked: "So what do you tell Armitage
and me with our living wills legalizing what you term suicide?"

"I can only hope that some aspect of the majesty of life from here on
out will tempt you to change your minds."

"And you want people like Armitage and me to end our lives like Mrs.
Carlson up in Extended Care?  Is that the golden triumph of your
teaching?"

"Senator Raborn, God plants on earth certain lives to serve as
measuring sticks for the rest of us.  These perplexing cases are not
here by accident.  He wants them to stand forth like beacons.  The
Down's syndrome child that tests the extent of a family's love.  The
hemophiliac boy of sixteen who contracts the HIV virus through a
contaminated transfusion.  Mrs.  Carlson in her slow, agonizing
departure from this life.  They are the litmus papers that enlighten
the rest of us.  Mrs.  Carlson ennobles this entire establishment.  God
is not testing you and me, He isn't ready for us yet, but He watches
how we respond to the litmus papers He has strewn about."

Senator Raborn had been respected as a bulldog on examining witnesses
who came before his various Senate committees and now he asked: "But
will you-I mean of course your society-allow my living will to be
executed according to the new Florida law?"

"Render unto Caesar the things which are Caesar's.  The Florida law is
a temporary aberration that I hope will be corrected in due course."

"And your group will do everything possible to revoke it?"

"Yes."

"I agree with you, Mr.  Hasslebrook," Jimenez said.

"You are a voice of reason in a troubled world."

"I fear you're a fanatic," Senator Raborn said, 'who will probably do
much more harm than good.  Keep your hands off my will, please."

President Armitage made a curious comment as the tertulia ended:

"Mr.  Hasslebrook, on our first meeting, if you recall it, you
impressed me as being unusually reticent and almost boorish.  Tonight
you're being the sophisticated Boston lawyer.  Why the change?"

"Simple, on that first night you were probing me with questions I was
not prepared to answer.  I had to feel my way along.  Now that you know
who I am, and what my mission is, I must show you the courtesy of being
forthright."

One night at dinner Judge Noble asked for the microphone and said in a
voice quivering with joy: "They're back!  The manatees started north
late this afternoon!"

The passage of the manatees to their warm refuge for the winter
provided no breathtaking beauty like a flight of Canada geese in their
sky-piercing V, and none of the exquisite charm of a snowy egret or the
solemn majesty of a stately blue heron.  To appreciate a manatee you
had to love nature per se, and to love the ungainly creatures, as many
did, you had to be just a bit off center.  But many residents that
first night set alarm clocks so as to be awake when morning broke and
they could watch the solemn procession of these strange water
creatures.

Early next morning Judge Noble was sitting in a chair with binoculars
and bits of food for Rowdy, the pelican, in case he came by.  But his
attention and that of those who clustered around his chair with their
own glasses, was on the center of the channel, where the manatees would
become visible.  Suddenly Ms.  Oliphant, always the keenest-eyed,
cried: "Here they come!"  and many residents had their first sight ever
of a manatee.

When one moved in close to shore, watchers saw a huge, blubbery
creature about fourteen feet long with a monstrous flat tail parallel
to the surface of the water.  The manatee is, in principle, much like a
small whale, but the torpidity of its movement makes it unique among
aquatic animals.  It is a lazy, loafing beast, but its lack of mobility
and easy charm make it lovable, like a worn teddy bear.

What had made it famous in sea lore was its amazing head, a large
misshapen blob, and a face with a blunt nose, vast drooling mouth and
whiskers that often in a certain light looked exactly like that of a
careless old man who no longer shaves or tends to his appearance.

Muley Duggan, joining the group and seeing for the first time a group
of manatees, shouted: They look like fat old men in a Turkish bath!"
and others agreed that he had the best simile of the day, but the
Duchess brought the comparison closer to the experience of the
residents when she cried: "That one looks exactly like my Uncle Jason,"
and then made a correction that sounded as if it was important to her:
"On my father's side."

As the beasts moved northward, Judge Noble explained: "They're very
partial to warm water, so you'd think they'd swim southward as cold
weather creeps in.  But there's a manufacturing plant north of Tampa
that pumps a good deal of warm waste water into the channel, and what
they're doing as you watch them now is locating the remnants of that
warm stream and following it to its source."

"How do they do it?"  a woman asked, and the judge said: Two theories.
Either extreme sensitivity to even the slightest modification of
temperature or some chemical trace deposited by the manufacturing
process."

As the morning progressed, the watchers from the Palms were witnesses
to one of the tragedies of wildlife in America, for the powerboats that
ranged these waters daily began to appear and pose enormous danger to
the slow-moving animals.

"It's so cruel!"  Noble complained.  The boats move so fast and
manatees are so slow, collisions become inevitable.  And the poor
beasts are chopped to death."  With his binoculars he studied a manatee
drifting along close to shore, and then he passed his glasses around to
show how horribly sliced up the hide of the creature was.

"One more hit by a speeding boat, and that one's dead," he told his
listeners.  The carnage each year is appalling."

"Aren't there laws to protect them?"  a man asked and Noble said:

"Yes.  And loyal officials to enforce them.  Powerboats are to slow
down and stay clear, but look!"

As he spoke, two boats in an early morning race to test their motors,
zoomed in from the south, roared past and headed right for the
lumbering creatures ahead.  It was obvious that if they maintained
their speed they must crash into the animals and chop them up savagely
with the razor-sharp blades of their whirling propellers.

"Slow down!"  the judge shouted impotently at the roaring boats as they
sped by, and, sure enough, the lead boat rammed into the big animals,
sliced one of them badly and veered off.

To prevent such disasters, Judge Noble used his handkerchief and two
borrowed from the other watchers to make a banner to alert the passing
boats to the presence of manatees.  When the drivers saw him waving
frantically at them, most tended to slow down and even come closer to
shore to see if an accident of some kind had happened.  When he
shouted: "Manatees ahead!"  they tended to go even slower and obey the
law, but a minority accepted the news as a kind of challenge and
actually revved up their motors to roar upstream and try to be first to
run down a manatee.

This so infuriated the judge that he told listeners: "Wish I had an
Uzi.

I'd blast those criminals out of the water," and when a man asked:

"How do you know about the Israeli killer-guns?"  he said: "When you're
a federal judge these days you learn a lot about Uzis."

Dr.  Zorn, who had watched the judge's futile attempts to stop the
lawbreakers, brought to the chair a used pool cue to which he had
attached a big red tablecloth and a small portable long-distance radio
that he had tuned to the frequency used by the Tampa Harbor Patrol.

Now the judge had both a very large visual signal to warn the boats,
and a radio signal to inform the police ahead: "Judge Noble at the
Palms.  Two Boston Whalers, one white, one green, passed here at thirty
knots and going faster to overtake manatees."

During the spells when there were neither manatees nor pursuing boats,
he shared his knowledge of these creatures with the residents gathered
around him: "Sailors as far back as Roman times saw an occasional
manatee and mistook it for a human being with the body of a whale, and
the men concluded that if there were these men, there also had to be
women, and of course, they had to be beautiful.  Hence the invention of
the mermaid."

As the lovely day drew to a close, Dr.  Zorn returned to express his
appreciation: "You made a lot of people happy today, Judge-they learned
a lot from you.  Thank you."

"Sit for a while," he said, offering the doctor his chair.

"I've been sitting all day and would enjoy moving about a bit, casting
my bait out farther might catch me some fish."

"Have you ever figured out why people get so excited about the
manatees?  They're not the world's most attractive water animals."

"I've often thought about it, especially today.  I think it comes down
to the problem of beauty."

"That's a word you can't use for those creatures."

"Yes.  And that's the precise problem.  Why did our people crowd down
here to watch the manatees?  They're probably the ugliest creatures on
earth, but more compelling than a fish of elegant design.  Is it
something primordial that attracts, as with an elephant, for example?

No way can the elephant be called beautiful, but he's so commanding.

Magnitude also counts.  And so, too, God forgive me for admitting it,
does color."

"What do you mean by that?"

"If you'd been here today you'd have heard them.  Whenever one of those
stately white egrets came to stand by me, hoping for a fish, the folks
cried: "Isn't that bird the most beautiful thing?"  But let a blue
heron stop by, an infinitely better-engineered bird, and no one
comments on his beauty, because he's the wrong color.  What did Muley
Duggan call that masterful fellow from our Heronry over there?

"A

village policeman on stilts."  A dark blue heron has got to be as
valuable to God in His animal kingdom as any white egret, yet we refuse
to admit it."

"Do you mean to say that being black affects even a man of superior
qualities like you?"

"Every day.  And I think it comes back to that word beauty and people's
reluctance to term a bird with black coloring beautiful."

"By the way, how did you become a federal judge?"

"It goes way back to when I was a draftee in the navy in World War Two,
eighteen years old and stuck away in the South Pacific serving on an
ammunition boat.  The white Southern officers of the navy refused to
believe we colored could fight, or that decent southern white boys who
made up so much of the navy would ever serve with us.  So we manned the
ammunition boats, and one after another of those dreadful ships
exploded, killing us in the hundreds and thousands.  If we were lucky,
we might land a job as waiter in an officers' mess.

"Somebody told me years later that I ought to go see that new musical
South Pacific, and I did, but I walked out.  That wasn't the South
Pacific I saw.  I was belowdecks hoisting ammo and wondering when ours
was going to blow sky-high."

"You mean that's all you did, work on ammo ships or in an officers'
mess?"

"Yes, the big brass had decided that's all we could be used for-the
limit of our capacities."

"How did that lead to a federal judgeship?"

Noble was diverted for a moment by his pelican Rowdy as he dived for a
fish.  When the bird came up with a big one, the judge called out:

"Go to it, Rowdy!"  Then he returned to Dr.  Zorn: "My redemption
started when I began going to the chaplain's office, the black chaplain
that is, to see the weekly New York Times Sunday edition, flown in a
month late.  Officers who saw me checking out the Times thought: That
guy Noble is trying to make something of himself, but what they didn't
know was that I was there to grab the magazine section before the other
guys tore it apart.  We all wanted to see those gorgeous longlegged
blond girls nearly naked in their lingerie ads.  One sailor joked:

"The white kids all rush for the National Geographic to see what
naked

black girls look like, but we rush for the Times to see the white
girls."  ' Then, as a trailing manatee wallowed by, he said almost
bitterly:

"The cruel fact of life, Dr.  Zorn, is that most of the girls in the
world are not beautiful.  They're not tall, and leggy, and blond, just
as the manatee out there is not beautiful.  But society conspires to
force on us the concept that white is beautiful and black is something
else.  Damn it, if even today I want to visualize a really beautiful
girl I go back to the lingerie ads in the Times."

At this point, when the manatees had completed their ponderous parade,
he caught a fish on his line, so a group of ever-watchful egrets and
herons flew in to demand their share of the bounty.  As the judge took
out his penknife to cut portions for the benefit of all, he gasped:

"My God, Zorn!  Isn't that egret magnificent with the sun on her white
feathers, turning them to silver!  And isn't that black heron at a
terrible disadvantage?"  Reflecting on this, he savagely cut his fish
in two, throwing the larger half to the heron, the smaller to the
egret, and when Rowdy came blustering in and landing in the water with
a big splash like a damaged float plane the judge snarled at him: "And
you, you clumsy oaf, you don't even qualify."

"Can I help you carry some of that gear back to your room?"  Zorn
asked, and he picked up the binoculars and the shortwave radio, leaving
the judge to handle his fishing pole, one he had acquired forty years
ago and had used in many streams.  As they walked toward Gateways, Zorn
said: "You still haven't told me how your duty in the ammo ships in the
South Pacific led to the federal bench."

"In a very roundabout way.  When some of us blacks got fed up with
running the risk, day after day in those steaming ports, of being blown
up, we protested what we saw as unfair treatment.  White officers from
the South who hadn't wanted to be assigned to the ships, either,
charged us with mutiny, and they might have made it stick, except that
a young white lawyer who had also been drafted and who came by the
office to read The New York Times and knew me to be a decent man, asked
to defend me at the court-martial.  He argued so beautifully, so
persuasively that when the case ended, with me set free, I told him:

"Come peace, I want to be a lawyer like you," and he said: "With the
recent GI Bill providing a free education when this is over, you can do
it."  We kept in touch, and years later he brought me to the attention
of Lyndon Johnson, who appointed me to be one of his federal judges."

As the judge finished his explanation, Zorn felt the urge to ask him
why he had left the federal bench.  Zorn had heard whispers that there
had been some sort of scandal, and when he looked into Noble's eyes, he
thought he saw signs of profound regret, as if the judge were still
under a heavy burden, but Zorn refrained from questioning him.  It's
strange, Zorn thought, other federal judges, when they retire from duty
fifty-two weeks a year, elect to remain on the available list, and from
time to time they are summoned to places where the back load of cases
is immense and they provide valued assistance, but Judge Noble never
seems to be called-I wonder why.

Darkness had now settled and as he and Noble looked at the outline of
the Palms in the late glow, he said: Thanks to your work today, Judge,
the people in there are a little more aware that they must respect the
natural world.  Thanks."

As they went indoors to prepare for dinner, the birds flew off to their
nests and the manatees moved ever closer to the warm waters in which
they would spend the winter.

In early October, when Berta Umlauf turned eighty-one, it seemed as if
the accumulated burdens she had assumed during the three prolonged
deaths in the Umlauf family came roaring back for a delayed attack on
her general health, her teeth, her eyes and her nervous system.  Of
course, prudent woman that she had always been and now a wealthy one,
too, she took care of herself.  She consulted an ophthalmologist, who
gave her good news: "Strong eyes, no glaucoma, no cataracts, no
detached retinas, but tired nerves.  While there's no danger of your
going blind, you will never again see as well as you used to, but with
better glasses you'll be more than able to function."

She also went to see Dr.  Velenius, the skilled dentist in the village
east of Tampa.  Learning from his allies in the Palms that she was
truly a wealthy widow, he did some basic work for her and charged her
outrageously, but she was inattentive and paid it.  When Andy learned
that she had become a patient of Velenius he did an imprudent thing:

"Am I being too nosy, Mrs.  Umlauf, if I asked what your dentist had
charged for his services  and she thought so little of the inquiry that
s she showed him the bill.  For routine services that would have cost,
at most, two hundred dollars in Chicago, he had charged eight hundred,
convincing her that she was on the verge of losing important teeth,
which had been her suspicion all along and the reason she had gone to
him in the first place.  Had he been asked about his fee he would have
said: "Giving her reassurance and eliminating certain real dangers was
worth every penny she paid."

But the danger to her nervous system was real.  She suffered dizzy
spells, unsteadiness in her legs and flashing spots before her eyes
that did not arise from ocular problems.  On two occasions she fainted
in her room without having received even the slightest warning of such
a collapse.  In fact, she scarcely knew that she had fainted, and had
she not found herself on the floor she would have been unaware of it.

She was frightened and consulted immediately with Dr.  Farquhar.

As always he was thorough, perceptive and helpful: "Berta, since that
day you visited me when your life seemed an overwhelming tangle, I've
been aware that you were susceptible to nervous exhaustion.  You push
yourself too hard, and your two fainting spells alert me to the fact
that you may be pumping an inadequate supply of blood to your brain. If
that's true, and you persist, you could be a candidate for a stroke.
I'm going to give you the full battery of tests starting tomorrow.
First the stress test, to see if it's coronary in cause.  Then a
standard EKG to check your heart.  Then I want you to go into Tampa for
a test of your carotid arteries, to be sure you're getting enough blood
upstairs to the head.  After that, and we hope those signs will all be
satisfactory, I want you to have an MRI scan of your brain to check on
any obvious problems, and again I feel confident we'll find nothing
grievous."

"Is that the one where Ludwig tore the place apart?"

"No.  The CAT scan isn't as sophisticated.  The MRI is a very advanced
test that produces excellent, clear images of the brain.  It isn't as
easy a test to take, but we have highly skilled technicians who make
the experience quite tolerable."  He reflected for a moment and
added:

"Of course, if you are subject to claustrophobia, tell us now, because
you'll never be able to endure the locked-in feeling.  No shame to beg
off.  Are you susceptible?"

She laughed: "What I'm susceptible to is Brussels sprouts," and the
regimen of tests was scheduled, but before it could be half completed
she awoke one night in a sweating, gasping panic, for she seemed unable
to breathe.  Obviously oxygen was getting through to her lungs, for she
did not faint or collapse, but the sensation of strangulation
continued, making continued sleep impossible.  By frantic
experimentation she learned that she could resist the attack by
propping pillows behind her back and head and sleeping with her torso
in an upright position.  As a woman used to facing crises, she did not
tug on the alarm cord, which would have summoned help from the main
desk.

She did, however, go next morning to consult again with Dr.  Farquhar
and realized anew what a difference a good doctor can make.  After much
thumping and listening, he told her: "I hear liquid in your lungs, not
such a vast amount as to scare us, but there it is, and it's got to be
driven out or real complications will set in," and it was only then
that both the doctor and the patient discovered her ankles were badly
swollen.

"That confirms it, Berta.  Congestive heart failure," but before these
ugly words could frighten her he added, almost with a chuckle:
"Horrible name for a very common ailment.  We have drugs to drive the
excess liquid out of your body and another medication to calm your
heart.  I have patients who've had congestive failure for thirty
years."  When he handed her the two prescriptions he warned: There's
one danger in the diuretic I'm giving you, that's the liquid expellant.
It carries away not only the excess liquid but also the body's supply
of potassium.  So you must supplement your diet with BOB-plenty of
bananas, oranges and beans-especially bananas."

"No problem.  I like them all," and when the swelling in her ankles
subsided and the accumulation of liquid left her lungs, her spells of
constricted breathing vanished and she had no more midnight bouts of
terror.

But her hard life and her continued assistance to others had depleted
her physical reserves, and controlling her treatments could not attack
her basic problem: that her genetic clock, which had been set at birth
to allow some eighty years of arduous exertion, was sending signals
that it was about to run down.  Curiously, it was she and not Dr.

Farquhar who interpreted these signals properly.  So when Noel and his
wife, Gretchen, paid their regular visit to the Palms, she told them,
with no dramatics: "I feel the power supply is draining away.  Too many
demands in too many areas."

"Mom!"  Noel protested, 'you're the type who begins to slow down in her
late nineties."

"But if I'm reading the signals correctly, I'll be moving in the not
too-distant future to the second floor over there, Assisted Living, and
when that time comes I want you to dispose of this fine apartment. No
regrets.  I've had a damned good time here, it owes me nothing."

"Mother," Gretchen cried, 'you'll be living here till you're
ninety-five.

Remember I said so."

"No, I've observed that movement from Gateways to Assisted Living is
usually irreversible.  Dr.  Zorn and Mr.  Krenek deny that.  They
always say when a resident moves over: "This is temporary.  We'll hold
your apartment."  But they know and we know that the movement is always
in the other direction.  We don't return here.  We move upstairs to
Extended Care."

"Mother, don't talk so fatalistically.  You're decades removed from the
third floor."

"No, Gretchen, I've worked there.  I know the probabilities," and four
days after Noel and Gretchen left, she had a major setback, which made
continued living in Gateways, with no assistance at night, impractical.
The ominous first step in the long retreat from life had become
inescapable, but she did not grieve when two male helpers from the main
desk arrived at her apartment with a stretcher to transport her to the
Health building.  She laughed and told them firmly: "I refuse to ride
in your carriage through the buildings.  It would depress my friends,"
and she insisted that they take the stretcher away.  Assisted by only
one of the men, she walked with a steady step to the elevator on her
floor, then along the length of the corridor leading to the Health
building and into the elevator that would take her to her future home,
a nicely furnished two-room suite in Assisted Living.  Had she disposed
of her apartment in Gateways, she could have made the switch from
normal to Assisted at minimal additional cost, but her family had
adamantly refused to let her abandon her quarters: "You'll be back
here," they had argued, and since she could afford the double cost, she
did not demur, but she did resolve to get rid of that apartment as soon
as they were not looking.

It was when she settled into the routines of Assisted Living that she
appreciated what this halfway house had to offer, and one morning when
she watched the trained nurses perform their functions so effortlessly,
caring for the needs of a dozen patients, she burst into tears.

"Mrs.  Umlauf!  What's happened?  Sudden pain?"

She reached out and grasped a nurse's hand, pressed it to her lips: "I
was thinking of the needless agony I suffered in that house over there
on Island Five, the one by the water with the red roof."  As other
nurses gathered at the window to see the old Umlauf house, Berta said:
"I went through hell in that little paradise, helping two miserable
people die, with me their only aid, responsible for everything, when
all the time this facility was over here, just waiting to be used." She
shook her head: "It was as if you young women were screaming in the
night air: "Hey, dummy!  Here we are, eager to ease your burden."  '
"And you never heard us?"  the nurses asked, and Berta said grimly:

"Oh, I heard you all right.  Loud and clear.  The voices of reason. But
the ones who were dying refused to listen or allow me to listen. They
rebuffed me with one of the crudest phrases I'll ever hear: "What would
the people back home think if we were put in a nursing home?"

They were more concerned about supposed friends in Marquette in
northern Michigan than they were about me, or, really, about
themselves.  And Marquette was nearly a thousand miles away."  She
paused, chuckled sardonically and told the nurses: "And I'll bet there
couldn't have been six people in Marquette who would have given a damn
if my mother-in-law and my husband had been over here in these fine
quarters."

One of the advantages of life in Assisted Living, she was discovering,
was that Dr.  Farquhar stopped by two or three times a week and could
spend more time in a patient's room than he had ever been able to
manage in his crowded office: "You're so available, Doctor, and you're
so reassuring."  He was more than that, a paradigm of what a doctor
should be, willing to make new diagnoses if earlier ones proved
nonproductive, always prepared to ask for the opinion of another
doctor, and not unwilling to look into new drugs that his patients had
read about in Reader's Digest or Prevention.  One day he laughed at a
suggestion Berta made: "I should subscribe to both those magazines.

They account for about half the calls I get: "Dr.  Farquhar, did you
read about this new miracle drug for bronchitis?"  The new drug rarely
accomplishes anything, but also rarely does any serious damage, so I
prescribe it.  Makes them happier."

Berta felt he performed minor miracles in keeping her alive and able to
function, shifting medication when she failed to respond to what she
was taking and monitoring her vital signs.  One day she told her nurse:
"When I watch Dr.  Farquhar, I have the feeling that I'm looking over
the shoulder of Hippocrates, the father of you all."

But as before, Farquhar could accomplish only so much, and the time
came in early November when he had to summon her children, Noel and
Gretchen, to share with them the bad news: "Your mother is declining
rapidly.  She no longer responds to normal medication, and we see no
probability that her vital responses will improve."

Noel tried to put the doctor at ease: "She predicted quite a while ago
that her genetic clock, as she called it, was running down and would
one of these days stop ticking altogether.  She's highly satisfied with
what you're doing to help her, so let's continue.  You may be sure you
have the full confidence of the whole family."

"But things aren't going as well as you and she might think.  She may
have a relapse."

These words were so chilling, coming from a low-key person like
Farquhar, that the two Umlaufs had no immediate response.  But the
crucial question had to be asked: "Dr.  Farquhar, are you trying to let
us down easy, that Mom hasn't much longer to live?"

"I'm making no predictions as to time, but yes, she is fading."

"And you're preparing us for the fact that she might, one of these
days, have to be moved upstairs to Extended Care?"

"Yes, that was my next point."

Noel broke down and could not speak, but Gretchen said: "We've never
talked about this among ourselves, but I guess we've always known.  You
think it's inescapable?"

"Yes.  The system in Assisted Living is not able to provide the
necessary care.  We'll have to move her."

This relapse-can you guess how soon it might occur?"  Gretchen asked as
the take-charge member of the Umlauf team.

"We never know.  It could be postponed indefinitely, but we must play
the averages, and in Berta's case-what a fighting little woman she is-'
The three sat silent, no one wishing to probe the next inevitable
problem, but after some moments Noel, recalling the oath they had taken
in Berta's living room, said quietly: "Mom prepared a living will.

My copy is in a safe back home and I believe hers is in her room.

Should I bring it to you?"

Dr.  Farquhar responded reassuringly, "Noel, she's nowhere near that
extremity-could be even years from it.  She's a tremendous fighter.
Ordinary rules don't apply to rare individuals like her."

"If she might have to move up to the third floor-' "Noel, you haven't
heard me.  She must be moved up by tomorrow night.  There is no
option."

The two Umlaufs sat silent.  They were prepared emotionally to hear
these words, had even speculated on them when Dr.  Farquhar summoned
them, but they found it difficult to accept the fact they applied to
tough little Berta Umlauf with her record of fighting off the
inevitable.

Seeing their downcast faces, Farquhar tried again to reassure them:

"She's moving to Extended Living, but it's not a death sentence.  Berta
may have many happy, full years ahead of her."

But it didn't work out that way, because shortly after midnight the
older Mrs.  Umlauf underwent what one of the aides termed 'a humongous
heart attack," which left her near death and so incapacitated that she
had to be taken by ambulance to a local hospital.  When Dr.

Farquhar rushed there to tend her he saw at once that recovery was
improbable.  But subsequent days proved what a determined fighter Berta
was, for she rallied, reestablished satisfactory heart rhythms, and in
time became stable enough to be transferred back to the Palms, where
accommodation was provided in Extended Care on the third floor.

Unfortunately, her tough mind did not make the trip with her; it had
been lost in this latest series of shocks, and when she was finally
bedded down in Room 312 on the third floor, she no longer had the
capacity to remember her association with the room once occupied by
Mrs.

Carlson, who still clung to life in a much smaller room because her
funds were running out.

One evening when Andy brought Betsy home from a movie at the mall, she
invited him to accompany her and together they went to her apartment in
the Peninsula, with its view of both the river and the handsome
entryway of tall palms and colorful oleanders.  She handed him the key
and when he pushed the door open she asked casually:

"Would you like a glass of white wine?"

He accepted eagerly.  Inside her apartment, she used her cane to slam
the door closed, and then, with a pronounced gesture of independence,
put the cane aside and moved about the room in her own secure but
cautious way.  Sitting on the couch, he watched with admiration as she
walked to her kitchenette and opened a bottle of white wine with a
corkscrew and then set the bottle on a tray with two glasses.  As he
watched her approach him, operating her legs carefully, he thought:

How beautiful she is!  When she came here last May her face was pallid,
pasty.  Now her long, successful battle has transformed it into true
beauty, like something carved out of marble."

This happy thought made him smile, and when she asked why he seemed so
pleased, he explained: "I was thinking how beautiful you've become
since coming down here, and how your mature new face reminds me of a
handsome carving in marble."

"Well, it's a good thing you said marble, and not granite, because
granite would have put me alongside those presidents on Mount
Rushmore."

Andy laughed and said, That reminds me of one of my mother's favorite
jokes.  She loved words and this always tickled her: "Our Uncle Josh
worked in a quarry but they had to fire him," and I was expected to ask
"Why?"  and she would say: "They couldn't trust his judgment.  He took
everything for granite."  She thought that was a real knee-slapper."

Betsy chuckled.

"I love those wonderful rural jokes," she said.

"I had a maiden aunt who used to play ask-me games with my sisters and
me:

"What did the carpet say to the floor?"  and she'd reply with the
greatest enthusiasm: "Don't make a move, Buster.  I've got you
covered."  She was also very big on: "What did the hat say to the hat
rack?

You stay here, I'll go on ahead."  But she had other goodies, too."

Andy returned to his earlier comment: "You really are far more
beautiful than when you arrived.  Yancey has done wonders."

Very carefully she said: "I believe the greater doctor was you," and
when he protested she said: "In those days when life was pure hell I
found only one ray of hope.  My image of you.  I hadn't a clue as to
what you looked like, only that you had come out of nowhere to save my
life.  I didn't need to know how you looked, I could feel your hands
lifting me up.  I could feel you throw your coat about my legs gushing
blood.  I could hear your voice assuring me that I would walk again.

On those memories I constructed a dream world.  There was someone out
there who understood me, who had saved me, a make-believe hero except
that I had proof he was real.  My job was to find him."

He reached across and embraced her ardently: "I'll be forever grateful
you did find me.  That you did is far more important to me than to
you."

"Is that really true?"

"Oh, yes!"

She kissed him, and snuggled happily into his arms.  She continued her
story: "Dad hired a detective to see what could be found, and he
learned from Dr.  Zembright that you'd been a doctor in Chicago and
that you'd quit your practice to work at something else in Florida.

After that you were easy to find."

Zorn drew back and looked at Betsy with an old fear: "Then if you'd
wanted to sue me for intervening, you could have.  You'd have had my
full identification."

"What are you talking about?"  and he told her of the warning Dr.

Zembright had given him about never interfering in a roadside accident
because he might be sued.

"Oh, Andy!  What a horrid thought.  You saved my life.  You're why I'm
here today-why I'm alive."  She kissed him, kept her head close to his
and whispered: "As long as I live, Andy, my life will be bound to
yours-no escape for me-and I hope none for you."

Then came the moment of decision.  She rose, put aside the glasses and
walked slowly toward her bedroom door, clearly meaning that he should
follow.  He did not move.  She saw his hesitancy and they stood
transfixed, each in a turmoil of fear and indecision.  She thought: Is
it

possible that he can't see me as a woman?  And she trembled at the real
question: Can a man love a woman with no legs?

And he was assailed by his own apprehensions: Could I support her
emotionally for a lifetime?  Is she suffering from girlhood fancies-a
dream concocted in her delirium?  I failed in one marriage, even though
it had once looked as if it would last forever.  Was it a terrible
mistake to allow her to come down here with her fantasies?  Has she any
concept of who I really am?

But in this long, agonizing pause, other, more powerful emotions took
over, and she spoke in strong, clear accents: "Andy, you're even better
than I dreamed back in Chattanooga.  You're a man among men, I see it
when you talk with residents, when you visit patients upstairs.  You're
the man I longed to find, and I can't let you go!  I love you!"

He moved forward to take her hand and he said: "It's terrible it took
me so long to wake up, but thank God you found me."  And he pulled her
to him hungrily.

When he left her apartment early the next morning they both knew they
were truly in love, a fact that would be affirmed on many following
nights, but each was also sadly aware that there were many obstacles to
a lifelong marriage.  But as they kissed in parting, each could be sure
that the other shared a great love.

Like millions of men and women who cherish their formal education
because they remember it as the means of escape from drab lives, Judge
Lincoln Noble felt that a man's spiritual year began not in January but
in October, and he had always approached each autumn with heightened
anticipation, as if the days were now doubly meaningful.  He had ample
cause for such feeling, because most of the good things in his life had
come in October.

Now in the cool, crisp middle of that month, so welcome after the
sizzling summer, as he lounged in Nurse Varney's office his mind went
back to that unbroken chain of meaningful autumns.

"I remember when I was six," he told the nurse, 'and Mother said as she
neatened up my new shirt and pants for my first day of school:
"Lincoln, what you begin on this day will decide what kind of man
you'll grow up to be."

Nora said: "I had that kind of mother.  Goaded me into nursing school,
thank God."

Like other residents, he enjoyed talking with the nurse, not only
because she was a fellow black with experiences somewhat comparable to
his, but also because she was an extremely understanding person,
whether her visitor was black or white, male or female, young or old.

He continued with his reminiscences: The October when I turned twelve
was memorable.  Then I moved into Thomas Jefferson Junior High and Miss
Lear growled at us: "The easy classes are over.  Now you have to bear
down and really work," and she was right, because my lifelong study
habits were formed in those three years by Miss Alien in English and
young Mr.  Barney in math.  You understand, this was in Mississippi,
and everyone, teachers and students, was black like me."

"Same with me in Alabama, and I never thought it did much damage,
except that never in my schooling did I have a new book of my own.

Always one ten years old that had been used up by the white children
and handed down to us.

"Now, the autumn I started Kennedy High was a revelation, because on
opening day the first thing I saw in the classroom was a vision, Edith
Baxter, a fifteen-year-old angel come to our town."  He stopped as
memories of that day flooded back.  Then he coughed and almost
whispered: "Very black hair bobbed in front, pigtails in back.  Light
complexion, and movements that made her seem as if she was floating.

But when I asked the other boys who she was, they told me: "Bad news.
Her father's no good, neither's her mother."  And during my three years
at Kennedy I had ample proof of those harsh judgments, because her
parents really were rotters, in constant trouble, big trouble.

But she seemed to sail serenely by, like one of those yachts we see
sailing up our channel, untroubled by the storms out in the bay."  He
paused again.

"So I remained friendly with her in spite of what Mother preached: "You
stay away from that child.  She come from trash, she be trash.  She
tainted, like her folks."  I never resolved the mystery, because Edith
did good work in school and sang in the church choir.

But everyone except me continued to think her tainted.

"My record at Kennedy was so strong-I graduated from high school with
honors-that all my teachers, and the principal too, urged me to go on
to college, and I wanted to but a problem came up."

"I know," the nurse said.

"You might call it "the black problem, money."  Your folks didn't have
any.  Mine neither."

"Money was a definite problem, but World War Two was an even more
immediate problem and I got drafted.  I can still recall the day in
October when I got back home after my tour in the Pacific.  It burns
like a slow, never-dying ember close to my soul, always there, always
smoldering.  Mother took me aside and pointed to my two sisters, each
older than me, each a fine person, Kate and Esmerelda.  She said:

"Lincoln, you got to go to college, but we don't have the money and
your GI Bill won't pay for everything.  I've been asking around the
community and good people are willing to give you nearly a hundred
dollars.  Your sisters say they'll help from the tips they make.  So
you go over to Jackson and tell them you're there for an education.
It's late, maybe too late, but if they look at your record, they'll
find a place.  I know it."  So that night my sisters helped me pack. It
didn't take long because I didn't have much, and the next morning I
kissed Mom and the girls good-bye-' His voice broke and for some
moments he sat looking through tears at the nurse, who understood such
moments.

Finally he said: "The girls, and you know this is true, they were as
bright as me.  They were girls of wonderful character, and it was the
tips they got in the restaurants where they worked that allowed me to
attend college."

Nora suggested they have coffee and some cookies she'd baked, and after
this pleasant recess, Judge Noble continued: "Those autumns in college
were glorious, each one opening a new vista on an enlarging world.
Ideas, moral problems, dedications.  My character was hauled out,
examined, fumigated and tucked back into place a lot better off than
when I started.  I couldn't explain to my family the great things that
were happening to me.  All they could see were my semester grades and
since they tended to be three A's and a B, they were satisfied that
they were making a good investment in keeping me in college.

"My record looked so good on paper that I was offered two scholarships
to law school, and when I showed Mom and the girls the letters that
made the offers official, we had a celebration.

"You'll be on the Supreme Court one of these days," Sister Kate
predicted and we didn't go to bed till midnight.  When I entered law
school I discovered that in comparison with white students from
colleges like Yale, Williams and Duke I was deficient in the kind of
general background knowledge that came from vacations in Europe with
wide travel and visits to museums and theaters, but in my ability to
study hard and learn at a fast pace I had to apologize to no one.  I
gained a spot on the law review, and after graduation I was invited by
a judge on the Alabama Supreme Court to serve as his clerk.  Then my
year really did start in the autumn, for then the court reassembled
after the summer vacation and cases began to be heard and decisions
written.

"All good things in my life sprang from that appointment as clerk to a
white judge.  Acting as my mentor, my judge introduced me to major law
firms in the South, assuring me: "They'll be hungry to land a good
black lawyer, Lincoln.  Keep your nose clean."  So I vaulted right into
an apprenticeship in a big New Orleans firm, and from that into a
federal judgeship.  How did that happen?  During my stint in the navy
I'd made a strong impression on a young white officer.  People back
home told my mother: "Nothing can stop Lincoln now," but they didn't
know Windy Wilson.  He sure had the power to stop me."

"I read about him in the papers," the nurse said.

"Was much of it true?"

"As you know, if you followed the case, all of it was lies.  The FBI
proved my innocence beyond question.  But the damage had been done.
When the story first broke there were calls for my impeachment-in all
the papers, television, Sunday news sections-and to this day most
people believe that I was actually impeached."

"I've heard it whispered here at the Palms.  Many people have been
accused of things they haven't done.  What matters is, they blustered
about impeaching you but they didn't do it.  You're home free.  You
kept your seat on the court, didn't you?"

This was true, though it was something of a hollow victory.  But at
that moment he was driven to concentrate on the real crime he had
committed, the deep kind that can scar a man's soul: "In Kennedy High,
when I was fifteen years old I fell deeply, passionately in love with
Edith Baxter, and I think she liked me, too, but pressure from everyone
scared me away.  We had a few secret dates, saw each other as much as
possible, and I learned that she had even vaster dreams than me.  She
wanted to be free of rural Mississippi and change the or world.  If I
now have a broader vision than most, it's because I knew Edith in those
days and nights of long thoughts."

Hesitating about continuing such revelations, he rocked back and forth
for some moments, then braved it: "I think you'll understand, Mrs.
Varaey."

"You don't have to tell me if you don't want to.  You backed away from
the one fine young woman in your life."

"Coward, I played the coward.  With her I could have gone to the stars
and, damn it all, I knew it all the time.  Jesus, what an ass I was. In
college I thought: I've left her behind.  She'll never catch up.  If
I'm to find a place in one of the big law firms I'll need a wife with a
college education.  I got such a wife, and she put me in touch with her
good friend Windy Wilson."

"What happened to Edith?"

"Graduated from high school with honors, couldn't go to college, girls
from backwoods Mississippi didn't go much in those days.  So she went
into social work, became a force to reckon with in the South and wound
up as one of the United States representatives at the United
Nations."

"You mean that Edith Baxter Jackson?"

"The same.  The little high school girl who wouldn't fit in as my wife
at a prestigious law firm."

Nora laughed, not at Judge Noble but at herself: "I sometimes look back
on the young men I might have married and ask myself: Of that wonderful
lot why did I pick the world-class loser?  None of us is vaccinated
against that malady."

The two friends laughed at the disasters that so often overtook worthy
members of their race, and although Nora could see that Noble wanted to
remain and talk further, she had to excuse herself: "Judge, I have to
check on Assisted Living and Extended Care.  That's what they pay me
for," and she left him sitting in her office.

After about ten minutes of mournful reflection, he rose, placed his
chair in its proper position and wandered into the kitchen to collect
whatever scraps the cooks had saved for his birds.  With a bagful of
bounty he strolled down to the channel where two noisy gulls aloft
signaled to their colleagues: "Here he comes again, loaded!"  and
almost instantly a swarm of gulls appeared to pester him for food. Next
came the three graceful herons; they looked exactly like the three
judges who used to enter the Louisiana courtroom together in their
black robes.

He liked those birds.

Then from the south came half a dozen snowy egrets, those poets of the
marshland, and they had become so accustomed to the judge and so
assured that he would have something for them, no matter how small or
scarce the fragments from the Palms, that they clustered about him as
if they were his children coming close to feed from his outstretched
hand.  They were his family, each with its distinct merits.  None flew
faster or with more grace than the gulls, those white bombardiers of
the sky; none were more beautiful than the big snowy egrets or more
delightful than the small cattle egrets.  But, as from the first days
with the birds, he reserved his chief approbation for the dark, stately
blue herons, with whom he identified in an almost non personal way:
They're noble birds.  Would that I could be like them.

Then, as his supply of food dwindled, he noticed with regret that the
bird he loved the most was missing.  Rowdy, the tame pelican, was
nowhere to be seen, not in the sky lumbering along in his heavy, slow
pace, nor in the water swimming awkwardly toward the shore.

"Rowdy!"  the judge shouted, 'where are you?"  When there was no reply,
he left a few scraps in the bottom of his bag and muttered: "Dinner's
here whenever you're ready."

Then, as his birds slowly drifted away, the egrets first, then the
herons, and finally the swiftly darting gulls, he was left alone with
the heavy thoughts that had assailed him in Nurse Varney's office: "I
did everything wrong.  I wasted the grandest opportunity a black man of
my day could have had placed before him.  In my first days on the bench
I should have written those legal essays I had so clearly in mind.

Four or five of the points I could have made then, they'd have
positioned me at the head of my generation.  Why didn't I do it?  The
issues I could have helped to clarify are the ones that perplex us so
much today.  I saw the light but turned down the wick."

The metaphor pleased him, reminding him of how in college he had caught
the attention of the professors because of the originality of his
expression when arguing a legal point, but his gratification was brief,
for his own words 'turned down the wick," summoned visions of the moral
darkness into which he had stumbled.

"Why did I allow myself to get mixed up with Windy Wilson?  His
nickname should have sounded danger signals and it did, but I wasn't
listening."  Lowering his head until his chin rested in his cupped
hands, he forgot the birds and the beauty of the channel and saw only
Windy Wilson, that fast-talking black man who had a score of ways to
earn a quick illegal dollar here and there.  Normally he would have
remained miles away from such a trap, even if he had not been a judge,
but Windy had been a friend of his wife's, had even dated her briefly
before her marriage, and when Ellen had insisted on inviting the fellow
to dinner, or had taken the judge to affairs at which Windy was
present, Noble had complied, even though his better judgment advised
against it.

Several times, when invitations were either issued or received, he
remembered the warning of a respected judge on New York's superior
bench: "Always bear in mind that if your butcher gets a bloodstain on
his trousers, it's an excusable consequence of his perfectly honorable
profession, but if you, as a judge, get a stain on your gown, it's a
major offense which all the world can see and which will, if the stain
cannot be erased, destroy your reputation and your career."  He had
elaborated:

"You do not even have to be responsible for getting the stain on your
robe.  Mud may have been accidentally spattered on you, but the stain
is there.  You shouldn't have been where mud was being thrown
around."

When the FBI obtained a court order allowing them to wiretap Windy
Wilson's very busy phone, they taped two separate discussions of two
court cases in which cohorts were involved.  Windy had boasted that the
men had nothing to fear 'because I have Judge Noble in my pocket." This
charge was so egregious that it had to be investigated, and even a
cursory round of discreet questioning revealed that Windy Wilson and
Judge Lincoln Noble were frequently seen together.  The FBI men did not
have to resort to hidden cameras.  Numerous photographs had appeared in
the national press.

It was never determined who leaked the news of the judge's pending
indictment, but the hideous boast "I have Lincoln Noble in my pocket'
swept the country, and several senators who had never approved of
promoting black lawyers to the federal bench saw Noble's case as their
chance to halt or at least slow down the process of appointing black
judges to the federal courts.

Impeachment proceedings were proposed, and although they never
occurred, for further investigation proved that Windy Wilson was
nothing but a loudmouthed petty hood, the damage was done.  Judge Noble
was allowed to remain on the bench, for there was no reason to depose
him, but any promotion was now out of the question.  He did compile an
honorable record and recovered some of his reputation for honesty, but
he knew the opportunity for any advancement in his career was over, and
without making any protracted effort at selfdefense, he retired, his
pension enabling him and his wife to live at the Palms.  Ellen's death
shortly thereafter had reinforced his propensity for solitude.

Now, as he sat alone in the autumn sunlight that had so often graced
the next step in his orderly progress up the ladder, he had the deepest
regrets, regrets he could not disclose to anyone: If I'd written those
essays and built a growing reputation and stayed clear of Windy Wilson,
I'd have been a leading candidate to follow in the footsteps of
Thurgood Marshall.  To keep the black dream alive.  To lend a voice of
reason to the Supreme Court.  I could have done it, I know it.

Then came the grinding, soul-searing truth: I might have been the one
to be moved forward instead of Clarence Thomas.  How preposterous it
was for George Bush to claim that in selecting Thomas he was choosing
the best-qualified judge in America.  How utterly ridiculous.  I can
name half a dozen other black judges infinitely better qualified, Leon
Higginbotham up in Philadelphia, to name one.

Then, when he was feeling most bitter, he came to the real reason why
he despised Thomas: that interview Thomas gave years before his Supreme
Court appointment.  When he made fun of his sister for being on
welfare, and added that her children had grown to expect the welfare
check as their due.  He denigrated the very sister who had stood by
him.  To have abused her was an act so shameful that he must regret it
late at night, when he can't sleep.  He befouled his race and his
family, who had supported him.

The judge was gentle in the analysis of the Anita Hill affair because
he was himself so vulnerable.  Could it be that my behavior was worse
than his?  That last date with Edith Baxter.  I'd come home from
college with those two law-school scholarship offers.  Stars were in my
eyes, and with their help I could see years ahead, the honors that
might await me.  And I said, to my eternal damnation: "Edith, I won't
be seeing you anymore.  Law school will be demanding, and there'll be
many new responsibilities.  There's no chance we would ever be mar
tied, so don't wait around for me."  I can hardly believe I said such a
thing.  In those words.  With those implications.  Well, I did, and if
I were to die tonight I'd go a lesser man than I could have been.

The remorse was cutting, like an errant winter wind blowing down the
channel and ruffling the feathers of the birds and his conscience.

Slouched in his chair he passed into a kind of amnesia, lost between a
scarred past and an uneventful future.  He was jolted from his mournful
reverie by a welcome sound.  Rowdy was back, belatedly, for his dinner
and was making his customary rumpus in the channel.  Judge Noble,
looking at him beating his big wings in the water, thought: Poor Rowdy,
what a clumsy bird he is.  But looking more carefully at the pelican,
he saw to his horror that Rowdy had got himself tangled in a long piece
of the extremely tough nylon filament used by fishermen.

The strands were twisted tightly around the bird's neck and not only
were close to choking him to death but also trailed so far behind that
they threatened to drag him down until he drowned.

As soon as the judge detected his friend's peril and realized that
Rowdy had used his last bit of energy to work his way painfully
upstream to where he knew the judge would be waiting to help him, he
jumped up from his chair and eased himself down into the cold waters of
the channel.  Calling words of encouragement to Rowdy, he moved out
cautiously to release the bird from its filament prison, but he lost
his footing and fell into deep water.  Twisting himself in the filament
that was stronger than steel wire, he dragged both himself and his
cherished friend to a watery death.

The three blue herons, marching like robed judges, returned to the
unopened brown bag on the ground by the chair and began pecking at the
paper until it split open.  Unaware of the double tragedy a few yards
from where they stood at the edge of the shore, they feasted.

On a brilliant moonlit November night, Ambassador St.  Pres waited till
midnight, then walked quietly to the improvised shed at the edge of the
narrow landing strip that had been mowed and smoothed.  There the plane
was tethered.  Looking at its sleek contours, the sturdy wings securely
attached to the fuselage and the shimmering propeller, he started the
procedure he had been taught by air force men when they served at the
embassy with him in Africa.  He checked the fuel with a measuring stick
that showed the gasoline level.  Then he crept under the plane to open
the petcock at the very bottom of the gas tank; this allowed any water
that might be in the tank to drain off, whether it got there by
contaminated gasoline from the pump or by condensation within the tank.
Smelling the last drops to be certain that they were gas and not water,
he closed the petcock, checked the two tires for proper inflation, then
tried to revolve the propeller to be sure it wasn't drifting loose. 
Walking to the end of each extended wing, he tried to push it up and
down to test its stability and finally unleashed the plane and pushed
it out to the takeoff line.  When it was positioned, he went to the
telephone that had been rigged into the shed and called the air
controller at Tampa International Airport: "I'm Ambassador Richard St. 
Pres of the Palms, south of Tampa.  You may have heard about the five
of us building our own small plane, everything but the engine.

Within a few minutes I would like to take off on a test flight, and
remain aloft about half an hour.  Have I your permission?"

"Ambassador, I'm honored that you bothered to call, but if you remain
under twelve hundred feet you need no clearance from me.  If you go
higher into our airspace, all hell will break loose."  Then I'm free to
take her up?"

"Are you cleared for night flying?"

"When I worked in Africa.  I keep my papers in order."

"It's OK, then, but I must warn you about one thing.  Our Coast Guard
planes monitor these shores looking for small planes like yours,
pirates sneaking in with cocaine.  No fancy maneuvers or they might
shoot you down."

"Can you alert them that I'm in the air?"

"Can do.  Will do.  It's a beautiful night for a flight."  Satisfied
that he had played by the rules, he returned to his car and moved it
into position so that its headlights illuminated the first half of the
strip.  Leaving the car with its lights on, he walked to the plane,
climbed in, fitted himself into the solitary seat and muttered a
prayer: "Safe skies and safer landings."  Then he turned on the
ignition, waited for the engine to turn over, checked the gas and the
various instruments and mumbled to himself: "Here we go!"

When he released the brake and jockeyed the plane onto the head of the
strip, he experienced a moment of immense excitement, but once the
plane started down the runway, his nerves steadied and he was again a
pilot taking off over the great African veldt.  When the required speed
was attained, he eased back on the controls, felt the nose of the plane
tilt upward as required, listened for the last bumps from the runway
and soared into the air.  No plane, no matter how skillfully built by
professionals, could have behaved better, and with this assurance and
the land below illuminated by the radiant moon, he turned to the right
and made a full-throttle run back over the channel, past the string of
building lots with the expensive houses and out over the Gulf of
Mexico.  Only then did he admit to himself the reason for what he was
doing at midnight in November, flying solo over the gulf: I talked them
into building this plane.  Whenever I saw them flagging, I told them:
"It can be done."  When my own fears assailed me I bit my tongue.  So
it was my moral responsibility.  I knew it was a sound job, checked
every detail and, thanks to Lewandowski, who has that critical eye, we
did it right.  But if it was going to go up in the air, sputter and
then fall to the ground, I could not afford, I simply could not
afford'-he gripped the throttle with both hands-'to have it crash with
everyone looking on in horror, and maybe the television cameras
recording the disaster.  I could not let that happen."

Now, safely aloft and with the gulf below him to smother his failure if
it did occur, he was satisfied that his friends had done a thoroughly
competent job.  The engine throbbed, the wings held fast, the compass
turned with the nose of the plane, the gas tank was nearly full, and
the grandeur that he had sought when he launched this enterprise was at
hand, so he headed far out into the gulf where the tips of waves
glistened in the moonlight and silence threw a cloak about the soft
rhythms of the engine, muffling its sound.  He was free, aloft in the
sky again as he had been decades ago when he flew for his life over the
vast areas of Africa.  He had been a novice then, brave and determined
to aid others, and tonight he was again a beginner, recovering the
skills he was afraid he had lost.  How magisterial the night sky was,
ahead an unbroken sweep to the hills of Mexico, behind the invisible
coast of Florida, and he was a free power floating between them.

Then a careful turn on the dropped tip of the left wing and a heading
back to land, with the dark sea behind and slowly the appearance of
lights ahead.  How deep in the experience of mankind it was to come
back at night across the sea, or the desert, or the snowbound tundra
and to see light in the distance and the promise of home!

"How strange," he said to himself as he headed toward the airfield and
the shed that housed the plane, 'that I should have come a stranger to
the Palms and allowed it so quietly to creep into my heart that now I
call it home.  I spent so little to acquire so much!  And there it is,
waiting in the moonlight."

In his euphoria he allowed himself a few bars of the gallant song the
air force men had taught him in Africa, the part about living in fame
or going down in flame, and his spirit soared.  Winging in at the
proper altitude and adjusting his flaps to serve as a brake, he
descended in what seemed like a roar, touched down exactly as planned,
turned slowly so as not to place strain on the outer wheel and taxied
back to the crude hanger.

He was met by Senator Raborn, who greeted him with the same kind of
reserve that St.  Pres showed as he climbed out of their plane: "I
could guess what you were going to do.  I had more or less planned to
do the same thing next week, if you didn't.  You wouldn't want a lot of
gawkers on a holiday staring at you if the thing went down.  That
wouldn't be fair to the Palms."

St.  Pres nodded as he helped push the plane back into its parking
place, and when it was tied down, Raborn asked: "How did it handle?

Light on the controls or heavy?"

"You know, Stanley, I haven't much to compare it with, so I don't know.
But it flew well, and the instrument panel lighted up nicely.  I think
we've done a good job, the others and Lewandowski.  I think his extreme
care gave us a margin of safety."

"So we'll take it up publicly right after Christmas?"

"As planned," St.  Pres said as he and the senator tied the plane to
its wooden-stake moorings.  It would have been unthinkable for the two
grizzled veterans to walk back to their cars arm in arm as a gesture of
their fellowship in this bizarre project, but St.  Pres did allow
himself to say: "Stanley, I did appreciate it when .. ."  He found the
words difficult-"I mean, when there was doubt about the project .. .
when the engine arrived and I could see that some wanted to draw back.
I appreciated your vote of confidence, forthright and loudly
delivered."

When Raborn said nothing, the ambassador said as they reached their
cars: "An equally loud voice against ... it could have come from
anyone, even you.... It would have destroyed the fabric .. . and I
might have joined the nays.  I'm sure you must have seen it in the
Senate when the fates of some enterprises of great moment depended on
the first speaker and the volume of his voice."

"In that case the trick is to be sure who speaks first.  You should
have tipped me off that evening, Richard.  In my committees I always
organized it."  He smiled, recalling important incidents, then said as
they reached their cars: "So it flies?  And three days after Christmas
you fly in it with the public cheering?"

"That was our plan from the start, wasn't it?"  And the two veterans of
many battles said good-night.

Nora Varney, as self-appointed surrogate mother to both Dr.  Zorn and
Betsy Cawthorn, knew that the time had come for her to act again, so
she invited the two young people to her house in Tampa for a
Saturday-night dinner.  They had grown so attached to Nora and so
dependent on her, each in his or her own way, that they were delighted
to accept.

When they reached the parking lot Andy headed for his car, but Betsy
said: "No.  I want to see if I can handle my own car at night," and he
said rather tentatively: "I suppose you have to start sometime."  She
chided him for being a defeatist: "Yancey would have said: "Let's have
a go!"  and he'd have cheered me on."

"But I feel responsible for you.  Your father put you in my hands."

"Are you ordering me not to drive?"

"I'm cautioning you to be very careful with the car."  And then he
added words he immediately regretted: "We've seen what dangerous things
cars can be."

She pivoted on her cane and faced him: "Andy, with Yancey's constant
cheerleading, I've recovered a confidence I feared I'd never have
again.  And now I'm on a roll.  So please don't stop me," and she
kissed him.

Assisting her into her specially equipped sedan, he helped her seat
herself behind the wheel and saw that she had positioned her feet in a
neutral spot away from the brake pedals, which would be of no use.  He
then reviewed with her the clever adjustments the car manufacturers had
made to the steering wheel with its brake activator, its turn signals,
its improved gearshift indicator and its simplified light controls.

This is really quite marvelous," Betsy said to strengthen the
confidence that Andy had diminished.

"On the run this afternoon things went so easily.  The mechanics of
this world are geniuses."

Since neither Andy nor Betsy had ever been to Nora's, the nurse had
given them a detailed map, and with this in Andy's lap so that a
dashboard light could play on it, they eased out of the parking lot and
headed east toward the intersection with Route 78 and the highway into
Tampa.  Andy gave turning instructions well in advance, and Betsy
cried: "This is a piece of cake!"  as they left the main highway and
eased slowly into the smaller streets that led to Nora's.  They could
not imagine what they were going to see when they got there.  All that
Andy knew about her living arrangements was that the Palms paid her a
good salary, that she was reasonably frugal, and that she had had a
husband and two children, but whether they still lived with her he did
not know.

As they drove through a depressed area of Tampa Betsy said: "How
strange.  We know Nora so well and rely on her so much, but except for
this we'd never know where she lived or how.  Two worlds so near, yet
so far apart."  At Andy's reply: "We don't know how the billionaires
live either," Betsy retorted rather sharply: "Since there aren't so
many of them, there isn't the same obligation," and Andy chuckled: "I
like it when you fight back.  Very promising signal, that."

The house was a small, neat one in the black section of Tampa proper
and appeared from the outside to be carefully tended.  He helped Betsy
out of the car and gave her his arm so she could negotiate the two
steps leading to the small porch just as Nora opened the door to
welcome them.  The first thing he saw inside was a big black-and white
basketball poster showing Jaqmeel Reed, Nora's talented nephew,
full-length in uniform in those days when he had been a nationally
known star.  It must have been taken well before he was stricken with
AIDS but Andy thought: Can you imagine it?  Already carrying HIV, yet
there he stands, invincible.  And then the swift decline.  Betsy, on
Nora's arm, saw tears in his eyes.

The ensuing conversation recalled Jaqmeel's glory days on the
basketball court and then the tragic story of his irreversible
disintegration.

"He didn't decline," Nora said.

"He climbed on the white horse of death and galloped straight down the
hill and over the cliff."

When they spoke in glowing terms about Dr.  Leitonen, and the crucially
needed work he performed so tirelessly, Betsy cried: "I'd like to meet
a man with that kind of heart!"  and Andy assured her: "It could be
arranged.  We still see him now and then."

She was also fascinated by the shadowy figure of Pablo, the agent of
death, but as they spoke of him she shivered and said: "I don't think
he should be allowed to roam."  Both Andy and Nora rebuked her,
pointing out the salvation he brought to young men who were in the last
stages of an inevitable, agonizing death.

"Don't they deserve a decent going away?"  Nora asked and Betsy
replied: "I wasn't thinking of them.  I was thinking of me.  In the
days following my accident the bandages about my knees were so huge and
lumpy I couldn't even close my legs, or go to the bathroom, or see any
hope in the years ahead.  I was in such despair that I considered
suicide, a quick, painless exit.  It was good that your Senor Pablo
wasn't available.  I'd have been tempted and it would have been
terribly wrong.  Who could visualize in those dreadful days that before
Thanksgiving I'd be dancing."  She shook her head: "How awful it would
have been to surrender to that momentary impulse!"  and Nora said
flatly: "You had an option.  With lost legs people have a chance to
recover.  But Jaqmeel-' Her unfinished sentence bespoke his unfinished
life, so that tears came to Betsy's eyes.

The two guests had noticed, when entering, that five places had been
set at the table, but they had not asked who else might be coming.  Now
came a rapping at the door, and when Nora opened it Andy saw with
pleasure that it was the Tom Scotts whom he had met at their Pelican
Refuge.  They looked bright and almost Christmasy, for they were
bringing Nora two gift-wrapped boxes which she placed in a corner of
her living room.

There was animated conversation about doings at the refuge, and the
Scotts wanted to know how affairs were progressing at the Palms:

"We heard the terrible news about our good friend Judge Noble, who was
drowned," Scott said and his pretty wife added: "How unfair!  To have
died trying to save an innocent creature-he could even have been one of
our own pelicans."

This observation caused some surprise, but Scott confirmed what his
wife had said: "Yes, those birds that congregate at feeding time on our
beach do roam as far north as this..  .. I'm sorry he died this way. He
was a fine judge who was done in by his friends."

Nora absented herself from much of the conversation to attend to pots
simmering on the nearby stove, for the social part of her snug home
consisted of one all-purpose room, and now she announced:

"Tonight I'm serving a dish my grandmother taught me to make: "Poor
folk better learn to cook the reeblie stew," she used to say."

"What could that be?"  Scott asked.

"Possum, maybe?"

"Chicken.  Reeblies, and I've never heard the word since I left home,
are little salted flour dumplings that you make when you rub a spicy
dough real fast on a board and stringy little bits fly off.  They're so
small they soak up the flavor much better than ordinary noodles, and
here's your reeblie stew."  It was delicious, a tasty chicken dish
thickened with the st ringlike reeblies and seasoned with just a little
pepper.

When the supper was well under way, Nora, from her seat at the head of
the table, rapped for attention and said: "This is like an Agatha
Christie mystery.  The owner of the decaying mansion says: "I'm sure
you must have been wondering why I invited you here tonight, you four
in particular."  Well, I did it for a very special reason, one long
overdue.  I wanted Betsy Cawthorn to meet Gloria.  Shake hands," and
although they had done so when the Scotts entered, they now shook hands
again, then looked at Nora for an explanation.  What she had to say,
delivered in a low, almost musical voice, was so bold and unanticipated
that the four listeners were stunned: "If there has ever been a couple
who ought to get married, who could be said to have been ordained by
God to marry, it's our beloved Betsy and our Doctor Andy.  But each is
afraid to speak, and for reasons anybody would understand.  He's afraid
to risk marriage again after his first one was such a disaster, and she
can't believe any fine young man like Andy could love a girl with no
legs.  So they look and wonder and spar like two boxers.  Well, I
wanted them to see you," she said, turning to the Scotts, 'because if
there ever was a couple who must have gone through mental hell before
they were brave enough to get hitched, it must have been you.  That
took the kind of courage few peoples have."

The two couples sat flushed with embarrassment, but she boldly plowed
ahead, letting the emotional sparks fly: "The important fact about
tonight is that I've been told by spies that Mrs.  Scott is
pregnant."

This stopped the monologue, for Gloria confirmed the rumor as her
husband smiled shyly, and both Betsy and Andy welcomed the break to
congratulate them effusively, glad to have the spotlight shifted from
themselves.  Nora came to the salient point of the evening: "I don't
want to know by what gymnastic or medical miracle our boy Tom, dead
from the waist down, got his wife pregnant.  But there the wee thing is
in her womb, and each day it grows bigger."

The room was silent, each of the four visitors driven to an emotional
frontier where darkness and indecision reigned, and sometimes a
distant, flickering light.  But Nora, who had connived to create just
such a moment, utilized it in a brazen way: "So Betsy and Andy, your
case is child's play when compared to their case.  You really don't
have no problem, two healthy, normal people, bar a couple of legs."

This was such a brash way of putting it that all four listeners had to
laugh, a reaction that Nora had hoped for, and this gave her courage to
move on to her next point, the burden of the affair.

"So, Betsy, the ball is in your court.  You wonder if you can ever have
a normal life, babies and all.  You can, the Scotts prove it.  And you
wonder if Andy will ever muster enough nerve to ask you to marry him.
He won't, he been badly scarred by his first disaster, takes the whole
blame on his self  The nostalgic effect of cooking a reeblie stew again
after some years and her mixing in the lives of two couples were
causing Nora to revert to more black dialect than she usually employed,
but it made her observations sound more basic.

"So if you wants to do a good thing for yourself, Miss Betsy, and an
even better one for him, you gots to do the proposin'."  In the silence
the two people from the Palms looked at each other, Andy struck dumb by
what he was hearing, Betsy trembling at this crucial moment in her
life.  But then came Nora's strong, reassuring voice: "It's simple,
Miss Betsy.  The words is: "Andy, will you marry me?"  ' In the silence
that followed, Betsy was more than prepared to ask the question, for
she had often framed it in her mind during those first bad weeks in
Chattanooga, and almost constantly since her arrival at the Palms.  But
as she was about to speak, Andy interrupted and said in a

low, trembling voice: Those are words that I should speak, Betsy.
I've tried to help you recover.  Will you now help me to do the
same?"

In response she reached across the table, took his hands, drew him to
her and gave him a long, loving kiss.

The rest of the evening was anticlimactic al and talk fell easily into
a random discussion of courtship, marriage, life and associated wonders
and disasters.  Gloria confided what the others might have guessed:

"I had to ask Tom to marry me, it was too big a leap for him to take
alone.  He said "Yes," thank God.  Think how I'd have felt if he'd
turned me down."

"I been turned down," Nora said, 'and it ain't pleasant.  One day my
man just up and left, no words, nothin'.  Me and the kids never saw him
again."

"What happened to him?"  Betsy asked, and Nora said: "Who knows?

He might be out there somewheres kickin' around like he did with me.

Raisin' two kids alone does present problems."

"Where are your children now?"  Andy asked and she said: "Both married.
Doin' pretty well.  I insisted on marriage, especially the boy.

Didn't want him to run around havin' babies he took no responsibility
for."  Turning to Zorn, she asked: "Tell everybody what happened in
your case.  It was bad to make you clam up like you have."

"It was epic," he said in a way that indicated he wished no further
questioning, but Betsy dug in: "I think that with what just happened at
this table, I'm entitled to know what epic means."

Reflectively, looking down at his thumbs as they massaged each other
nervously, he said: "Let's start with the fact that whatever happened
was seventy percent my fault.  Young doctor, pretty nurse, he was
straight-A average after grammar school, she was from the country.  She
was adorable, and during the years of my internship and then
establishing my practice when I often worked all night, she discovered
a couple of guys who were more her style, and one of them showed her
how, with a good lawyer, she could work it so that the burden of the
divorce would fall on me and she could net a pretty good settlement."

"You call that seventy-thirty?"  Scott asked and Andy said: "I had
often left her alone at night-women do have their babies at the
damnedest hours.  It really was my fault because, strange as it may
sound, I never even knew it was happening.  Young, dumb, obsessed with
my own problems at the clinic and further study to keep up in my
field-' He could not continue, but Gloria asked: "She took you to the
cleaners?"

"Totally."

"Did she marry the other guy?"

"I preferred not to know."

"But you do know?"

"I don't know, and if you do, don't tell me."

Mrs.  Scott chortled: "Watch out, Betsy, damaged goods!

Psychologically crippled."

As soon as she said this unfortunate word, so inappropriate when both
her husband and Betsy were present, she looked stricken and put her
fingers to her lips, as if to erase what she had said, but Betsy came
to her rescue: "If Bedford Yancey can cure me of my affliction, which
seems less damaging each week, I'm sure I can cure Andy of his," and
the guests in the room applauded, but Nora said sardonically: "Betsy,
that's the chorus of us black women: "We can cure the guy of whatever
is eatin' him," but when we try, we find it's eatin' us, too."  And
Betsy said: "Come visit us six years from now.  This man has saved my
life.  I can afford to take a risk in trying to save his."  And they
wished her luck.

But Nora had not yet finished with the subject into which she had been
accidentally led: "I'm not afraid to use the word crippled.  I carry a
set of scars you'd need a surveyor to diagram."  She shook her head in
disbelief at what she had undergone with her man, then said
philosophically, addressing the two women: "You white girls can't
appreciate the difference.  When you go to your school's senior prom
you see a dozen boys there that would be pretty good bets.  Of course,
at that age you can't pick the all-time winners like him'-she pointed
to the portrait of Jaqmeel-but you can reasonably expect that at least
one or two of the boys are going to grow into significant manhood.

And if you're lucky, you'll catch one of them."

She became much more serious: "But with us black girls, we go to the
same dance at our school, and our speculation is: Which one of these
clowns is goin' to find a job?  And if he gets a job, will it ever pay
enough to take care of our kids?  And we can look around us at the
black women in their thirties or forties who never solved that problem
and had no chance to do so in the first place."

She was speaking with great bitterness: "Now in my high school group
there was maybe only two black boys seventeen years old who was goin'
to tear the world apart, as good as any white kids in town, but girls
sixteen and seventeen cannot identify those winners.  All we can do is
stand back and marvel at them when they're in their forties and we are
too.  They were the transatlantic liners that pulled out to sea,
leavin' us watchin' from the dock."

"But white girls can also make very bad choices," Betsy said.

"You see it in a southern city like Chattanooga.  The Deep South can
produce some real male losers, and nice girls seem to gravitate toward
them."

"Yes, but the odds are so much more favorable for you white girls.

Don't you understand?"  Nora asked, her voice becoming almost a plea:
"At a black girl's graduation, when she looks at six black boys, four
of them are not goin' to get jobs in those important years when they
need them and two of them are probably goin' to be dead by twenty-two,
shot in street brawls.  That's what we black girls see."

"But you survived," Betsy insisted.

"You have a fine job.  Everybody in the Palms loves you because you're
a wonderful, caring woman."

"I was determined to make it that way when I moved in.  I'd had enough
of the horse manure this nation throws in the faces of us black women.
I had to succeed."

Betsy, with tears in her eyes, asked Zorn to help her, and she pulled
herself up, reached across to the head of the table and embraced
Nora:

"You did more than succeed.  And, Nora, you did a damned good thing
tonight."

One morning before the Thanksgiving holidays, a trio of agitated widows
descended upon Ken Krenek, demanding that he summon Dr.

Zorn for an important meeting.  With the two men listening intently,
for the women were obviously serious in their protest, they heard an
impassioned rendition of a complaint that they had heard before.  At
first they were inclined to laugh at what seemed a situation worth no
more than an amused dismissal, but as Zorn was about to handle it that
way, Krenek, who had learned to take the grievances of widows

seriously, said: "Now, tell us again, what exactly is your complaint
against Muley?"

"Last night at the long table he went too far."

"In what respect?"

"His jokes.  He went way beyond the bounds of decency."

"Now, ladies, you know that Muley is a rough-cut diamond.  He livens up
the place with his jokes."

"But they've been getting more and more vulgar, and this one was just
too much."

"What did he say?"

"We refuse to repeat it," and Mrs.  Robinson snapped: "If Patrick had
ever told a joke like that in our dining room, or kitchen either, I'd
have thrown him out of our house."

When it was clear that none of the widows would repeat the offensive
joke, Dr.  Zorn did his best to mollify them: "You shouldn't have to
listen to offensive jokes, especially at dinner.  I'll speak to Muley
and warn him that he must clean up his act."

"I assure you our protest is not trivial," Mrs.  Robinson said, 'and
when you hear the joke he told, I'm sure you'll agree."

When the ladies were gone, Andy asked Krenek to fetch Muley if he could
be located.

In a few minutes Ken arrived with the ex-truck driver, red-faced and
chuckling at some new joke he had collected and shared with Krenek.

Andy went right to the point: "Muley, three of our women came in here
objecting to one of the jokes you told at the long table last night.
Since these women are not chronic complainers or prudes who feel
insulted if a man says damn, Krenek and I have to take their protests
seriously, especially since the incident occurred at dinner, when there
are many people around."

Muley leaned back, rubbed his chin and after a long pause said
brightly: "Oh, yes!  I'd just heard this beauty about three old codgers
sitting in the morning sun on a bench in St.  Petersburg, known widely
as God's Waiting Room.  When I used that title, the women laughed, so I
was encouraged to go ahead."

"Share the joke with us," Krenek said.

"Let's see how offensive it might have been."

"These men in their late eighties were comparing health problems,

and the first says: "My only serious complaint is I can't urinate
easily.

It's a real problem."  And the second says: "Same kind of problem, but
with me I can't have a bowel movement.  And that can be nerveracking."
The third man says: "Now, that's funny.  I empty my bladder every
morning, at seven o'clock sharp.  And I have a complete bowel
evacuation every day at eight."  And the two others said: "You are
really lucky," but the third man held up his hand and waved it back and
forth: "Not so fast.  You see, I never wake up till nine."  ' His two
listeners could not suppress their amusement, and Krenek said: "Rough,
I'd agree with the women, but it's certainly not grossly offensive."
Andy, however, pointed out: "It could get by in the billiard room, but
in a dining room, with meals being served-I think they had a right to
complain."

"But look!  I go to the long table to eat by myself, down at one end.

They crowd around to hear my stories.  I don't crowd around them."

"Let's leave it this way, Muley," Andy proposed.

"Continue to entertain the ladies, they enjoy it, but remember that
they are ladies, not truck drivers," and Muley, chastened by the
complaints, promised to sanitize his yarns, and that night at the long
table he sought out the women, sat among them and told them jokes more
to their liking.

Later that night, when Dr.  Zorn was checking on recent improvements in
the appearance of Assisted Living he became aware that familiar music
was coming out of the room long occupied by Muley Duggan's wife,
Marjorie, and he wondered who was playing the tape Muley had
transcribed of her favorite operatic selections.  He stopped outside
the door and heard those heavenly female voices in the duet "Mira o
Norma' but he also heard Muley's voice, pleading with his wife and
calling her by the name he had given her when she was still able to
understand and appreciate music.  Now, far advanced in her Alzheimer
affliction, she could not respond to the music in any way, and this
apparently frustrated her husband, for he was pleading with her:
"Norma?  Listen to the music!  It's your music, Norma.  I made the tape
for you.  Norma, please listen!"

Andy was aware that he was eavesdropping and that he ought to pass on,
but there was something so heartrending about the situation that he was
held in position as if icy hands had gripped him.  Suddenly Muley
shouted: "Goddammit, Norma!  Listen to the music.  It's your music.  I
made it for you-to keep you happy."  Silence, then: "Norma,

for God's sake, listen to it!  Please!"  But, of course, she could not.
His heart aching for poor Muley, Andy slowly moved away.

Some weeks later Krenek, Nurse Varney and Zorn received formal
invitations from Muley to attend Marjorie Duggan's sixty-eighth
birthday party, which would be held in Muley's spacious apartment in
Gateways at five-thirty on a Wednesday afternoon.  At four Muley
reported at his wife's room in Assisted Living to dress her for her
evening meal, and on this occasion he brought along the hairdresser,
who made sure that she looked as beautiful she had in the early days
when she was the cynosure of the Palms: a tall, graceful queen with an
entrancing smile.  So perfect was her blend of physical charm and
social grace that Muley's guests could hardly take their eyes away from
her.

On this night the hairdresser and the two nurses had re-created the
beauty of the younger Marjorie, and when he escorted her into the
apartment, where some two dozen of her former friends waited, the crowd
broke into spontaneous applause, both for her and for her devoted
husband.  The dinner was a genuine pleasure, for by good luck she
behaved herself as if some fragment of understanding had mysteriously
returned, making her aware that this was a special occasion.  The
flawless skin seemed more radiant than ever and she was, however
fleetingly, the woman of ultimate grace who had captivated everyone in
the past.

A week after this celebration, which went smoothly and without
incident, the nurses in Assisted Living telephoned Muley at four in the
morning: "Mr.  Duggan, we think you'd better come over right away.

Yes, a coma like before, but much deeper.  Please come."

Trembling, he slipped into his clothes as he mumbled: "Dear God, don't
take her yet.  Please, please allow her to come back home, like
before."  But when he hurried to Assisted, he was stopped before he
could enter her room and told: "She died peacefully."

When he was finally allowed in the room he insisted on taking charge of
dressing her in a gown she had particularly liked and in brushing her
hair as he used to do, and in attending to all details, even though the
nurses said: They'll have to do it over again when they prepare her for
the funeral."

These words, intended to be helpful, had such a note of finality that
he collapsed in tears, and nothing could halt the flow.  He created
confusion when he demanded to ride with her corpse to the undertakers,
where he created more confusion by wanting to remain with her during
the preparation of the body.  Two men had to draw him away and drive
him home.

At the memorial service Reverend Quade reminded the residents of how
gracious Marjorie had been, how helpful to everyone, and said in
conclusion: "She was a woman who walked with beauty and with music, so
we shall send her from us on the wings of the songs she loved," and
from Muley's tape Mrs.  Quade had selected the "Barcarolle," from The
Tales of Hoffman, and the duet from Norma that had been Marjorie's
favorite.  When that duet faded, the listeners started to rise, but
then, miraculously, came an angelic, far-off echo of the voices and the
ceremony ended.

In the days that followed, the people of the Palms gained a new insight
into the meaning of death, for even the least observant could see that
Muley Duggan was declining almost as rapidly as his wife had.

He did not want to be with people.  He told no jokes, and residents
found him wandering aimlessly.  In Assisted Living the nurses had to
tell him to stop tormenting himself by wanting to visit her room, and
often at dinnertime Krenek would have to dispatch a waiter to bring him
down to a meal he did not want.  He sat alone, and while he did not
rebuff anyone who might ask to join him, he said little and left
abruptly before dessert was served.

One day when he asked to see Reverend Quade she did not wait for him to
raise the subject of his wife's recent death and burial: "All your
friends have been worried, Muley, about the grief you are suffering.

But those of us who've worked with Alzheimer's patients know it was, in
a very real sense, God's benevolence that allowed her to die without
extended agony.  When we prayed at the service, Muley, we were thanking
God for His kindness."

"Not me," Muley said.

"She was the loveliest woman God ever made, and I'd have been happy to
care for her till the end of my life."

"We know.  Your acts of love enriched us all."

"Mrs.  Quade, do you believe .. . what does your religion say about
this?  When I die, will I be reunited with her in heaven?"

This was the brutal question that clergy could never avoid.  Death of a
loved one was such an overwhelming blow that even people who had never
thought much about religious explanations now wanted to know, and Helen
Quade was not one who could answer the question in a way to give the
bereaved the assurance they sought.  Through the years, and from the
teachings of many different societies in which she had served as a
missionary, she had developed her own carefully considered idea of the
afterlife, but it was not one that she could explain to another, not
even a fellow religious leader, in a brief conversation.  So, as a
sensible leader of her flock, wherever it chanced to be, she had
adopted the strategy of answering the terrible question like Muley's in
this manner: "Christianity teaches us that in heaven we shall be
granted eternal life, and surely this means that we will be reunited
with our loved ones."  She never said or even intimated that the Bible
promised reunion with loved ones, nor did she find reassurance on that
matter in the Church Fathers.  The concept was a late invention, but
she felt she was doing little harm in telling those who had already
convinced themselves on the subject, "Christianity teaches that we will
be reunited," because some branches of her faith did.

So now, when Muley pressed his question and she saw how eager he was
for an affirmative answer she repeated her standard ending 'we will be
reunited," and she watched his face glow with a peace that had
previously eluded him.  He told her: "You can't imagine how much I
loved her, this society figure, attending operas and balls, and me a
lousy truck driver who went to smokers when I was making my way in New
York.  When she accepted me as her second husband, it was like a
rainbow filling the sky."  Wondering whether he was saying too much, he
added: "It wasn't money, you understand.  Her husband talked a lot but
he didn't leave much.  I had far more than she did, and it's been my
money she lived on down here.  I wanted you to know."

"Muley!  You don't have to apologize for anything.  All of us in the
Palms looked upon your love for Marjorie as a highlight in our
experience.  You were a wonderful husband," and when she saw how his
face brightened, she repeated: "You will be reunited with her in
heaven," and he left her with a smile and a lighter step.

At about four next morning the Duchess, who had a keen ear for
suspicious sounds, telephoned the main desk and told them she had heard
a muffled gunshot somewhere in the upper floors.  But when the night
men investigated, they could find nothing, and the night nurses in
Assisted and Extended said they'd heard no sound like that.  Dawn came
and the night men reported Mrs.  Elmore's call, so Ken Krenek made
investigations and uncovered nothing.  However, when he checked
attendance at dinner that night, a ritual carefully observed in a large
building with many elderly people, he found that Muley Duggan was
absent.

Suddenly nervous, he called for one of the guards to fetch a master
key, and when they entered Muley's apartment they found him in bed, a
heavy revolver in his right hand; a high-caliber bullet had ripped
completely through his brain to exit at the top of his skull.

At his funeral service six different men recited his wildest jokes,
even the naughty ones, so that there was much laughter as his neighbors
recalled his boisterous ways.  On a more serious theme, however,
Reverend Quade eulogized: "Muley taught us a new definition of the word
love, and in the end he proved to skeptics that a man truly can die of
a broken heart.  We watched it happen, and let us pray that this
wonderfully loyal man is now reunited with his beautiful bride."

But she could not bestow benediction upon herself, because she had good
reason to suspect that it might have been her reassuring words about an
afterlife of reunion in heaven that had encouraged heartbroken Muley
Duggan to take his own life in order to join Marjorie.  In her distress
she asked Ambassador St.  Pres if he might have time to talk with her,
and when he joined her for a walk under the palms, she posed the
question: "Did I do something terribly wrong when I promised Muley that
he would be reunited with Marjorie?  Whom he loved so desperately?  And
around whom his life was built?"

"If it's part of your faith, of course you were justified.  It seems to
have been a significant part of his."

"That's the ugly part, Richard.  It's not part of my religion.  I find
nothing in the Bible that promises reunion with spouses.  It's a late
invention, to make people feel easy."  She strode along, kicking at
pebbles, then added: "One reads damned little in the Bible about
wives.

Has it ever bothered you that all twelve of Christ's apostles were men,
and I wouldn't be able to guess whether any of them had ever been
married.  Our New Testament is rather silent on the married state.  And
it isn't much concerned about remarriage in the hereafter for the good
reason that the men weren't much concerned about it in the here and
now."

"Helen, I must warn you.  You're riding the theme of your book too
hard.  Look at the great love stories in the Old Testament, as in the
last chapter of Proverbs, where women are idealized.  I think you can
extrapolate from them and deduce the concept that those married on
earth will likewise be married in heaven."

"I have this dreadful fear that it was my counsel, lightly given and
not explained because I did not want to confuse him in his sorrow-' She
burst into tears: "I was a poor shepherd to my lamb when I told him
something that may have speeded his death.  It hangs heavy on me, and
then to allow his jokes to be told at his service  I must have been out
of my mind these past days."

"You are not, Helen.  You were edging your way along after you were
shocked, we all were, by Marjorie Duggan's death, which we applauded as
the termination of an evil and a burden on Muley.  I was as deeply
shaken as you were-' "But you were not in a responsible position.  I
faced a major test and failed.  Mea culpa, mea culpa," and he said:
Those are the sacred words that preface enlightenment, that suggest
wisdom is at hand."

"You're a dear friend, Richard."  Then as they returned through the
grand gate she said: "I have a feeling that I received more meaningful
help when I consulted you than poor Muley did when he consulted me."

For some years, with approval from Chicago, the Palms had allowed the
scientist Maxim Lewandowski and his wife, Hilga, to occupy an
additional room without additional cost.  In this rather small space
Max had installed a filing cabinet, a word processor, a computer, a fax
machine and a high-quality television set with special controls for
easy use of videotapes.

When his burgeoning scientific reputation had been damaged by the
controversy over the extra Y chromosome, he was discredited as a
serious researcher.  And his academic career was ruined.  Fortunately
both he and his wife found alternative work; they saved their money and
were able to move into the Palms at a much reduced rate.

The instruments that crowded his small office had been paid for by a
consortium of universities and scientific centers in the United States,
England, Sweden and Japan who recognized his unparalleled skill as a
researcher.  The schools sent him tasks whose solutions would speed
their work, and which would be verified by other scientists.  What the
consortium was seeking, as were hundreds of other researchers in other
countries, was an answer to this complex question: What causes
Alzheimer's, why does it strike certain individuals and not others, and
what triggers the onset of the disease in which large deposits of a
translucent waxy substance collect in the brain, causing the loss of
normal mental functions?

Breaking this gigantic puzzle into its many component parts meant that
any brilliant new insight into any portion of the tangle might cast
light on half a dozen collateral topics, for as a researcher in Japan
pointed out: "We're looking for needles that can be enlarged into
mountain ranges."

Dr.  Zorn, having been told by members of the tertulia of the
fascinating talk Lewandowski had given them on his researches,
suggested to Krenek that it might be rewarding to invite the scientist
to talk informally to the residents about his work, and Kenneth, with
his entrepreneurial skill, devised the perfect announcement for the
affair: THE SECRET OF ALZHEiMER's, but when Maxim saw the poster he
forced Krenek to take it down: "I got into deep trouble when the
newspapers proclaimed that I'd uncovered the secret of criminality."
But he did allow: RECENT ADVANCES IN ALZHEIMER'S, which attracted a
full house of fascinated listeners.

He began soberly with an astonishing fact: "In nations that keep
records, Alzheimer's stands high among the scourges of mankind.  The
causes of death, in descending order, are heart disease, cancer,
stroke, Alzheimer's."

This was immediately challenged by several questioners, but he stood
his ground: "It's my business to know.  But I'll have copies made of
the studies that prove what I've just said," and he handed Krenek two
studies for the Xerox machine.

"The insidious disease produces a massive breakdown of the
communicating system in the brain.  A translucent waxy substance called
an amyloid protein is deposited in areas that clog and finally halt the
delivery of messages from one part of the brain to another.

"There is no medical test that will prove that a patient has
Alzheimer's; only an autopsy after death, when the horrible
entanglement that can be seen by even an amateur proves that the person
had

Alzheimer's.  The diagnosis while the patient is still living is
simple:

"We've proved that it isn't anything else, so it has to be
Alzheimer's."

But as you've probably seen for yourselves, the symptoms in people you
love are devastating.  Loss of memory.  Loss of ability to recognize
friends or even close family members.  Loss of control over bodily
functions.  A mad desire to break loose and wander.  And finally
commitment to a bed twenty-four hours a day, and a suspension of all
normal vital functions except mere existence.  That's the hell of
Alzheimer's, a living death.

"Is that all we know?"  asked a woman who suspected her husband might
be developing the dreaded affliction.

"We know a tremendous lot, that's the business we're in.  There seem to
be numerous parts of the human system whose malfunctioning could cause
Alzheimer's-the bloodstream, the lining of a vein, the weakness of a
crucial part of the brain, a failure of an inhibitor-and at each of
these many spots there could be a multitude of things that might go
wrong, and to complicate things further, there is a staggering
multiplicity of theories-guesses, if you wish-to explain why things go
wrong."

"What are the things that can go wrong?"  a man asked.

"Well, there are forty-six chromosomes, each strand containing its
multitude of genes, perhaps millions in all, and each aberration is
susceptible to a hundred or more scientific explanations."

That's an overwhelming problem."

"Not really.  Daunting but not impossible.  We have a steadily
accumulating knowledge about the chromosomes.  We know for instance
that a problem in Chromosome four results in Huntington's disease,
cystic fibrosis seven, eye cancer thirteen, kidney disease sixteen,
muscular dystrophy nineteen."  Then he paused, studied the attentive
audience and said: "Now follow me closely, taking down numbers if you
wish, and I'll ask Mr.  Krenek to bring in the blackboard he has in his
office.  Here we go into the wonders of the human genetic system."

"Sometime ago it was discovered that Chromosome twenty-one was related
to a curious disease.  Babies born with three components of twenty-one,
as opposed to the normal two, always developed Down's syndrome, and I'm
sure many of you know what that is."

"Produces mongoloid infants."

"We don't use that phrase anymore.  It's already a terrible
affliction,

doesn't need an ugly name, too.  But the interesting thing is
that anyone who has Down's syndrome also has many of the brain
patterns-the tangles, that is-the amyloid-protein blockages of
Alzheimer's.  Tests have shown that Chromosome twenty-one is the
villain that produces the amyloids."

"So is the mystery solved?"  a man asked.

"Heavens, no!  From tests in Sweden we also know that a defect in
Chromosome fourteen definitely accounts for the type of Alzheimer's
that starts conspicuously early in life.  So we know firmly that twenty
one and fourteen are somehow involved.  So you might think we'd direct
all our brainpower on the analysis of those two, and hundreds of
brilliant researchers are doing just that."

"I have to conclude from what you've said and how you said it,"
observed Senator Raborn from the audience, 'that you yourself are onto
something else?"

"Yes.  Mysterious evidence, not yet well supported, has filtered in
from various sources, like Livermore in California, Duke here in the
East, that Chromosome nineteen is also involved.  It seems to
contribute, and my specific job is to accumulate whatever evidence
surfaces- I'm what you might call the garbage collector, looking for
anything at all that might involve nineteen.  As researchers around the
world untangle the genes of Chromosome nineteen-and that may take
decades because the chain seems endless-we'll eliminate those that have
no apparent bearing on the problem and report to the world whatever
minute bits of solid evidence we've collected."

"You say lots of countries are involved in the search?"  a woman asked,
and he said enthusiastically: "Oh, yes!  Venezuela provided a major
clue for Chromosome twenty-one, Sweden gave us the hint on fourteen,
and Japan has been an active contributor.  It's a worldwide effort."

"So what you're all striving to do is solve the mysteries of the human
race?"  Raborn asked.

"You make it sound too grand.  I myself am working on only a tiny piece
of a vast puzzle.  I'm an expert in genetic structures, contributing my
bookkeeping skills, my past knowledge, to assist the brilliant young
scientists who are doing the demanding laboratory work."

"Are you getting any closer to an answer?"  a woman asked.

"Madam, there are ten thousand questions.  An answer to them all?

No.  But if our group can affirm or eliminate one small segment of that
tangle, we'll have made a true contribution."  He felt so strongly on
this point that he spoke with extreme gravity: "Are you aware of what
we're attempting?  To compile an atlas of the entire genetic structure
of the human race.  When others are through with their work in the next
century, experts will be able to look at any human deformity, any kind,
and pinpoint the gene or genes that cause the problem, and maybe
correct it.  Did you know that even today skilled doctors can cut into
the womb of a pregnant woman, go into the fetus and adjust anomalies in
the gene system of the unborn, sew everything back up and await the
birth of a normal baby?  Yes!  We can do that now."

"Don't you feel as if you were playing God?"  a woman asked.

"I've thought about that frequently since coming to the Palms.  The
purpose of my life's work, what does it mean?"

"And your conclusion?"  a man asked.

"That God, when He fashioned the universe, left in it a handful of
puzzles, which man is challenged to solve.  The wheel, what a marvelous
invention.  Electricity, how wonderful.  The operation of the blood
system.  The discovery of the great galaxies.  A vaccine for polio. The
adjusting of the human eye so that we can manufacture glasses to enable
us to see.  On and on it goes, intelligent man solving the great
secrets God left on the table before us.  Radio, television, the atomic
bomb, and now the wild secrets of the gene system, millions of them
hanging on to those forty-six chromosomes."

"You speak like a poet," one of the men from Assisted Living said, and
Lewandowski replied: "Or a philosopher, or a scientist who has wrestled
with these problems all his life."

"Do you anticipate any solution to the Alzheimer mystery?"  asked one
man.  Another: "How about AIDS?"  Yet another: "Or the common cold?"

"I sit in my little research center close to your rooms and place one
minute building block after another in its proper order."  Turning to
the blackboard, he took a piece of chalk and said: "I thought you might
like to see what I work with while you're asleep.  This is from a
communication I received today from Sweden," and with great care,
checking his letters as he wrote them on the board, he showed the
audience this message:



SEV KM DAEFRHDSGYEVHHQKLFVFFAEDVGSHKGAIIGLMVGGWIATVIVITLVML

"It's quite exciting, really, a breakthrough in relating one part of
the beta-amyloid sequence to another.  When we accumulate enough of
these linkages we'll have mapped the entire human genome, maybe
sometime around A.D. 2040."

"Are you working in the dark?"  a man asked.

"Me personally?  Yes.  I cannot see the grand pattern evolving, but I
hope that someone like me working in Copenhagen or Kyoto will sense it,
and bang!"  He slammed the lectern.

"We've solved another one.  In my lifetime, apparently no sure solution
to Alzheimer's.  In yours?"  and he pointed to one of the waiters who
had lingered to hear the talk: "Yes.

Surely the work we're doing now will unravel this mystery by then."

When the lecture ended, Zorn accompanied Krenek to the latter's office
and along the way he said: "You did a great job, Ken, in arranging that
talk.  Who'd have thought so many would be interested-and be able to
follow what he was saying?"

"That's the secret of a place like this.  It looks to be a collection
of exhausted warriors idling in the sun as they recall old battles. But
these people are still in the middle of the fray.  Senator Raborn flies
to Chicago next week to try to knock some sense into his Republican
party.  Armitage is on a committee to wrestle with the problem of
conflict between conservatives and liberals on college campuses, Max is
struggling with Alzheimer's, and did you know that Nora is deep into
the problem of how to provide nursing care for young men dying of
AIDS?"  As he entered his office he said: "I don't think that even John
Taggart realizes it, but a man like me, in his fifties, actually loves
these old geezers.  They give me hope that I'll have thirty more years
of activity."

He entered his office, took a magazine from his desk, and said: "And
look what our beloved Raul Jimenez has been up to!  A masterly
eleven-page essay with photographs and specific names detailing the
crimes the Medellin and Call cartels in his homeland have committed in
both Colombia and the United States.  He's in the forefront of the
battle, and residents take great pride in having a fighter like that in
our midst."  He reflected on this judgment for some moments, then said:
"So in this dreamy little world of ours, which seems so soporific with
old

men and women living out their last days, we find ourselves in
the front line."

When they were settled in Krenek's chairs, Zorn said: "Ken, I'm worried
about that crazy airplane the men have built.  I can see real trouble
rising out of that nonsense.  You know, I suppose, they've moved it out
to an airfield, but did you know that the other night, by himself,
completely alone, St.  Pres sneaked out there at midnight and flew the
damned thing by himself?  Way out over the gulf, back over the
savanna."

"He did!  I'll be damned!"

"Now, if they take it up right after Christmas as they plan, and the
newspapers and television crews are here watching, and something goes
wrong and there's a crash-' He shuddered, then asked: "Do you suppose
you could persuade them to call it off?"

"You say he flew it?  Successfully?"

"Yep."

"Andy, you might be able to talk Jimenez and Armitage out of it, and
maybe Lewandowsi, but Raborn?  No.  He's Nebraska-tough.  And St.  Pres
will surprise you.  He's the polished gentleman, socially correct and
urbane, but they tell me he was the one who got his whole embassy out
of a tight spot in Africa.  I can assure you that he does not scare
easily, and if you propose to him and Raborn to drop the subject,
they'll-' "You want them to try it, don't you.  You're on their
side."

"I am.  At their age, give it a last shot.  I'm told that if St.  Pres
doesn't fly it, Raborn will.  Believe me, Andy, you are not powerful
enough to browbeat those tigers."

As he walked back to his apartment, where Betsy waited, Andy wondered
if Krenek was right, that these adventurous old men were entitled to a
last flight, and he thought: Maybe they are.  But one thing's for sure,
even if they do get the damned thing in the air and down, next day
they'll have to find somebody to give the plane to.

When Betsy greeted him with excited approval of Lewandowski's talk, he
said: "It staggers me.  So much amazing activity in this place.

Lewandowski probing the innermost secrets of the human race, the men of
the tertulia building a plane that actually flies, Nora fighting to
find a way to help young men suffering from AIDS."  He kissed her and
broke into laughter: "And you and me trying to figure out the next step
in our lives."

In early December Noel and Gretchen Umlauf found themselves at a
terrible impasse regarding their mother's care at the Palms.  For
several weeks after her heart attack, Dr.  Farquhar and a team of
experts tried every medical means available to bring Berta back to
consciousness, but all to no avail.  After weeks of failure and a
battery of sophisticated tests they had to conclude that during her
heart attack the supply of blood to her brain had been cut off, causing
irreversible damage.

With a heavy heart, Dr.  Farquhar called Noel and Gretchen into his
office.  Since their mother's heart attack they had been staying at a
hotel near the Palms but spending most of their days and evenings in
anxious vigil by her bedside.

"Noel, Gretchen, in my many years as a doctor I have seen some
extraordinary cases of recovery from patients who seemed doomed, had no
hope.  I had a male patient with prostate cancer who I didn't think had
more than a couple of months to live.  Well, that was two years ago and
the old codger beat me last weekend at golf.  I had another patient, a
woman with ovarian cancer.  Again, her doctors, myself included, didn't
give her much time left on this earth, but she went into remission and
lived several years, enough time to see her own daughter marry and give
birth to a daughter herself.  So there are extraordinary cases-miracles
are really what they are.  And as a friend, you know that's what I'm
praying for in your mother's case.  I am very fond of that tough little
woman and want to believe that somehow she'll once more become the
Berta we all love.  But as a doctor, I have to tell you that I don't
believe there is any hope of her recovering.  Her brain has been too
badly damaged for her to ever be herself again.  I don't think she'll
wake from the coma she's in now."

With tears streaming down his face, Noel tried to answer.

"I've feared there's no hope, Doctor.  I've sat by Mother's bedside day
after day and looked in her eyes, and there's nothing, there's nothing
there-' He covered his face with his hands.

Gretchen, fighting to control her own emotions, spoke up, "Dr.

Farquhar, we've brought the living will that Mother drew up.  The sort
of death-in-life existence she's in now is what she most feared.  If
there

really is no hope of her recovering, then I know she would want
us to follow the instructions in this will.  In fact, we promised that
we would honor her wishes."  She withdrew the document from her purse
and handed it to Dr.  Farquhar.

He read each page carefully, then put the document down and sat quietly
for a moment staring at his clasped hands.  Then he looked up at Noel
and Gretchen: "If it's all right with you, I think we'd better call
Dr.

Zorn in."

Farquhar dialed Zorn's office, spoke to him quickly in a low voice,
then picked up the will from his desk, and excusing himself went to
wait for Zorn in the hallway.  When the director of the Palms arrived,
Noel and Gretchen watched the two men in conversation.  They were both
frowning and Farquhar was pointing repeatedly to something on one page
of the will.

When they finally joined Noel and Gretchen in Farquhar's office, Zorn
greeted the couple gravely and took a seat.

Farquhar began: "Neither Dr.  Zorn nor I want to add to the terrible
burden you are under right now.  But I'm sorry, the Palms simply cannot
follow the dictates of this living will."

"But why not?"  Noel asked.

"It makes Mother's wishes completely clear."

"Oh, I believe that these are Berta's wishes," Dr.  Farquhar replied,
'and so does Dr.  Zorn, but this will is invalid."

"What?"

"It's archaic.  Who drew it for your mother?"

"Mother used a book she got from a library."

"Either that book was terribly wrong, or Berta misread a crucial
instruction," Zorn said, shaking his head sadly.

"What can we do?"  Noel cried.

"I know a good lawyer in town," Dr.  Farquhar said.

"Laurence Brookfield.  Very experienced.  I want you to talk to him.
Maybe he'll know how to straighten this out."

After some discussion and phone calls it was arranged that lawyer
Brookfield would meet the Umlaufs at Dr.  Zorn's office at nine the
next morning.  Also present at the meeting were Ken Krenek, Dr.

Farquhar and Victor Umlauf, a third-year law student at Columbia, who
had caught the first plane to Florida the previous evening when his
parents had called him about the defective living will.  They all

listened intently as Brookfield confirmed what Dr.  Farquhar and
Dr.

Zorn had told the Umlaufs: "Yes, I'm afraid the good doctors are
right.

This patched-up will is not valid in the state of Florida."

The stress of the past weeks had pushed Gretchen close to the edge and
now she fairly shrieked: "Are you going to sit there and tell me that
because of some stupid technicality-' "Now, ma'am," the lawyer
interrupted, 'it is not a stupid technicality.

The law was designed to protect older people like your mother.  It's
usually blood relatives who have the most to gain from the death of an
elderly family member.  Requiring at least one witness to be from
outside the family is the law's way of trying to check familial
greed."

Seeing the Umlaufs' shocked and angry faces, he apologized:

"Obviously, I know this is not the case in your own family.  Clearly
you love your mother very much.  But now, let us face the facts in this
case.

Your mother, a wonderful woman of sound mind, made her wishes known.
She wanted no heroic measures used to keep her alive after her brain
was dead, having witnessed right here in the Palms the pitiful excesses
to which such procedures could lead.  We know what being allowed to die
means in the regular steps God has been using for the last five million
years.  We all know that was her wish, and she even put it in clear and
unambiguous language.  We all know that."  He stopped and nodded at the
various listeners, who nodded back.

"But the one that matters most, the legal system of the state of
Florida, does not know, because the paperwork defining her wish was not
properly drafted.  To follow the dictates of such an improperly
executed will would put Dr.  Farquhar and the Palms at tremendous
risk."

"And we certainly don't want that," Krenek interrupted.  Zorn knew
Krenek was right, but he felt sick to his stomach.  Once more, it
seemed, the legal system was going to make it impossible to do the
ethically and medically correct thing.

Now Victor spoke up.

"There's got to be something we can do."

Carried away by his youthful enthusiasm, the law student spent some
minutes rattling off court decisions in Missouri, Oregon and California
that tended to prove that in other states, at least, families like the
Umlaufs had been given permission to terminate heroic measures to keep
senile elder members alive.  Lawyer Brookfield listened attentively,
then congratulated the young fellow for his thoroughness in citing
precedent.

"You are right, young man.  And there is some hope that we can
accomplish the same thing here in Florida.  What we need to do is
obtain a court order making one of you, and I think that would be Noel,
judicial guardian.  As such, you would be empowered to make health-care
decisions for your mother."

As Brookfield explained the court procedure, the Umlaufs began to feel
some hope that their terrible dilemma would be solved.  But then
Brookfield went on: This morning as I was leaving my house to come here
I received a most unpleasant call from a lawyer named Hasslebrook. He's
with that very powerful organization Life Is Sacred."

Zorn groaned.

"Somehow," Brookfield went on, 'he had learned I was coming to this
meeting and what it was about."  The lawyer looked sharply at Zorn and
Farquhar.

"I don't know what's going on in this establishment, but if I were you
I'd find out who in Extended Care or in your offices is passing
information to this character."  The lawyer continued: "He demanded to
speak at the meeting.  Said he'd make life hell for the Umlaufs, for
the Palms and for me if he didn't get a chance to be heard.

His threats sounded serious enough so I asked him to come by at ten."

Zorn looked at his watch; it was almost ten.

When the Umlaufs protested a stranger's becoming involved in their
family's business, Brookfield said, "I apologize for his intrusion. But
he has one tremendously potent weapon that he's not afraid to use.

Publicity.  So watch your step.  Don't antagonize this nasty fellow."

Just then, Nurse Varney rapped on the door to say Dr.  Zorn had a
visitor, and in came Clarence Hasslebrook, still slightly obsequious,
still grimly determined to have his way, still looking uncomfortable in
his new clothes, still a squirming but formidable figure.

Brookfield said: "I think those of you associated with the Palms are
acquainted with lawyer Clarence Hasslebrook, a resident of Gateways and
a distinguished lawyer from Boston, Massachusetts.  As a member of the
nationwide organization Life Is Sacred he has a considerable interest
in the Umlauf case and insists on ensuring that no moves are made that
would end Mrs.  Umlaufs life prematurely."  Hasslebrook said nothing,
but when young Umlauf cried: "We'll get a court order,"

he smiled indulgently.  When this infuriated the young fellow so
that he swore: "We know what Grandmother wanted and we'll fight this
battle in her behalf," Hasslebrook finally spoke: "You do not know what
your grandmother wanted.  I can get a sworn affidavit from a nurse who
attended your grandmother during her heart attack and heard her beg
that every means possible be used to preserve her life.  Like many
people she had a change of heart when she finally looked death in the
eye."

Noel gasped.  Gretchen, the more perceptive of the two, said, "Mr.

Hasslebrook, you are lying.  I know my mother-in-law better than you or
any nurse does.  I know how much it pained her to see her own
mother-in-law and husband live out their last months as vegetables.  I
know in my heart that she did not change her mind when facing her own
death."

"And we'll convince the court of that," Victor added.

"We'll see about that," Hasslebrook replied coolly.

"Your family is determined to end your grandmother's life and has the
money to pay a lawyer to help you, but the Society will protest your
petition.  In fact, we'll petition the court to have me named as legal
guardian.  We've decided to make this a test case, relevant for all
states where efforts are under way to legalize the wanton murder of old
folks."

This accusation was so blatant, and so palpably wide of the Umlauf
situation, that Noel sprang to his son's defense: "Mr.  Hasslebrook,
we're a standard American family, churchgoers, voters, taxpayers and
country club members.  We are not weirdos on the fringe, we're at the
very heart of America.  And we're going to fight you every inch of the
way to establish the right of the elderly person in full possession of
her powers to decide that she does not want to be kept alive when any
reasonable hope for recovery is gone."  And there the tense meeting
ended.

To the local press, Noel and Gretchen explained that they were only
asking the court for 'the right to disconnect the tubes, to halt the
power to the machines, to allow the inner forces that have kept Mother
alive for eighty-one years in an orderly God-directed way to run their
natural course.  That's all we ask, that's all Mother asked in her
living will.  That right we shall fight for."

Administrator Krenek gave orders that no strangers be admitted to
Extended Living and that the nurses there protect the tubes and ma 9
chines controlling Mrs.  Umlauf s life: "They are not to be disturbed
or ruptured or turned off by anybody."  Two security guards were
employed to monitor the reception area and the elevators, and both Dr.
Farquhar and lawyer Brookfield had the unpleasant duty of informing the
Umlaufs that they were now professionally bound to keep their mother in
Extended Care.  This meant, in effect, that they could no longer take
any step that might look as if they were encouraging or hastening the
death of Berta Umlauf.

The case took a dramatic turn two days later when- young Victor Umlauf,
outraged by what was happening to his family, sneaked through a rarely
used back door onto the third floor, spoke tenderly to his comatose
grandmother before giving her a kiss, and started ripping off the
various bits of apparatus that were keeping her alive.

Alerted by the medical alarm, Nurse Grimes rushed to Room 312 and
lunged at him as she shouted for the other nurses to help her.  Four
young women grappled with Umlauf to keep him from destroying the
crucial equipment.  Soon the extra guard on the elevator, a burly man,
arrived to help, and Victor was dragged away.

In the morning Hasslebrook announced there would be no more such
incidents.  A local judge had issued a restraining order directing
young Umlauf to stay clear of the third floor or find himself in
contempt of court and facing a jail sentence.

The case, of course, became a cause celebre with headlines in papers
and interviews on television.  Conservatives nationwide made
Hasslebrook a hero as a defender of human life, while liberals tended
to side with the Umlaufs, even though they were a staunchly Republican
family.  Young Victor Umlauf became a celebrity, and when he sneaked
back onto the third floor in a second attempt to aid his grandmother
and was thrown in jail for contempt of court, signs proliferated
demanding his freedom.

Noel Umlauf, feeling himself largely responsible for launching this
brouhaha, posted bond for his son's release but backed away from any
responsibility for the fracas.  His feisty wife, Gretchen, however, had
become so agitated by the patent unfairness of the situation that one
night she persuaded her son to ignore the court order, sneak back and
this time really disrupt the machines.  He did succeed in getting back
and reached his grandmother's bed, but Nurse Grimes again spotted him
and he was thrown into jail for an additional fifteen days.  Again
signs covered Tampa calling for his release and for Berta's right to a
decent death.

Throughout the hubbub, Clarence Hasslebrook remained unruffled,
fortified by his battery of court orders.  To many, he was the old
lady's protection against her unfeeling family, and when in another
part of Florida an elderly man perpetrated a mercy killing of his aged
and failing wife, there was a public outcry among the elderly: This is
what we're trying to stop in Florida.  Life truly is sacred."

But the Umlauf group was not powerless, even though Victor was in jail.
They quickly learned to use the press, too.  Gretchen wanted to show
the media what Mrs.  Umlauf had been trying to fight against, and
secretly brought two newspeople to inspect the small room in which Mrs.
Carlson still remained in bed, dominated by a bank of efficient
machines that could do everything for her but activate her brain and
control her elimination.  Gretchen, remembering the oath she had taken
to protect her husband's mother, asked the press people: "Is this how
you would want your mother to end her life?"  and she asked them to
guess how long Mrs.  Carlson had been stuck away in a room like this,
and then gave the answer herself: "Nearly half a year in this hellhole.
Almost two years in a decent room out there.  Total cost to society?
Upwards of a quarter of a million dollars.  Cost to the Carlson
children?  Bankruptcy."  With that and other bits of evidence, public
opinion began to turn in favor of the Umlaufs.

At this critical point, Berta regained a degree of consciousness and
seemed dimly aware of being attached to the various tubes.  When the
staff discovered that she had succeeded in pulling out the IV from her
arms, Nurse Grimes overreacted wildly and had her put into a
straitjacket, a terrible invention consisting of a shirt with very long
sleeves that could be wrapped completely around the body and tied the
second time in a tight knot in the middle of the back.  The person
restrained in this way-desperate criminal, convicted killer or demented
patient giving trouble-could not move his or her arms or attend to
bathroom needs.  It was a barbarous punishment, uncivilized even for a
fractious jail prisoner but unthinkable for a fragile old woman.  When
the Umlaufs learned what had been done, they appealed to Kenneth
Krenek, who said that he was powerless to countermand the nurse's
orders in Health, and he advised the family that Dr.  Zorn did not have
that privilege either.  Nurse Grimes's decision stood.  A defeat for
the euthanasia freaks but a victory honoring the dictates of Clarence
Hasslebrook's committee.

But the other Umlaufs were not powerless, for that morning, when
Berta's law-student grandson was again released from jail, his mother
and he entered into a conspiracy.  Though Victor was barred from seeing
his grandmother, Gretchen bullied her way onto the third floor before
Nurse Grimes was aware she was coming, and she saw with horror her
mother-in-law lying imprisoned in a straitjacket immobilizing her arms.
The tubes were back in place, the various machines were functioning and
Berta Krause Umlauf looked vacantly into her daughter-in-law's eyes as
if pleading: Gretchen, you swore to protect me from this.  Gretchen
replied as if she could be heard: "Oh, Mother!

What have they done to you?"

Gretchen, forty-two years old and not a powerful woman, swore that her
mother-in-law would be released from this tyranny one way or another.
She kissed Berta and called for the head nurse.

"Surely the laws here at the Palms don't permit patients to be
restrained like this?"  and Nurse Grimes replied: "The laws do permit
it.

Dr.  Zorn would be quite angry if he saw this, but your mother has been
quite intractable."

"Unfasten her, now!"

"You have no power to give me orders.  If you don't leave I'll have to
call a guard."

"As a relative, I have a right to be here.  Now, back off while I free
my mother."

Younger and stronger than Nurse Grimes, Gretchen elbowed her aside, and
began to undo the straitjacket.  Set free after hours of imprisonment,
Berta stared into her daughter-in-law's eyes, and as Gretchen bent to
kiss her good-bye, she thought she saw gratitude in the old woman's
eyes.

When Gretchen was halfway to the elevator she felt quite sick and
looked about her for some place to relieve herself, but Nurse Grimes
had returned with a guard and asked brusquely: "Now what does your
precious court order permit you to do?"

"I am looking for .. ."  Gretchen began weakly, and then cried in a
loud voice: "I'm about to vomit!"  And she did so, in the middle of the
hallway.  Glaring at Nurse Grimes, Gretchen wiped her mouth and said
bitterly: "What I saw in there made me sick to my stomach."  As she
left the floor, she vowed to herself: Tonight, God willing, she will be
set free.  Her son listened to her story of his grandmother's suffering
and said: "Mom, she's got to be released, I agree.  But if I were to
defy the court again, I could be thrown out of law school.  Are you
brave enough to try something really crazy?"

Gretchen Umlauf was not one to relish deeds of derring-do, nor did she
want to imperil her son's chances at law school, so she said: "We've
got to give the sensible people here one last chance before we do
anything drastic.  Let's tell Dr.  Zorn about the straitjacket.  He's
on our side."  They asked for an appointment, which he granted, but
reluctantly, because he knew there was little he could do to help.

"Dr.  Zorn, are you aware that my mother-in-law is being brutalized on
your third floor?"  Her report of what she had seen angered Andy, and
he started to reach for the phone to order Nurse Grimes to stop such
abuse but stopped himself in time.  He was all too aware that until the
court came to a decision he could not interfere in the proper medical
treatment of Mrs.  Umlauf, and he knew medical testimony in court would
probably support what Nurse Grimes had done as legitimate procedure
when dealing with an uncooperative patient.

He said wearily: "Come back in one hour.  I'll discuss this with my
staff," but as they departed, young Mrs.  Umlauf warned: "If you don't
act, we'll have to," and from that resolve she did not waver during the
hour they waited.

Zorn asked Krenek and Varney if they had been aware that grave abuses
had occurred on floor three, and they had to confess that yes, they'd
heard that the straitjacket had been used.  When he stormed:

"Why didn't you discipline Nurse Grimes?"  Nora replied in a low
voice:

"Because one of my girls saw her and Hasslebrook having dinner the
other night.  You even touch Mrs.  Umlauf and you'll cause an even
bigger ruckus.  Can you imagine the publicity if they present her as
the defender of human life and you as the unfeeling destroyer?"

A sickly chill came over Andy, for once again he was trapped in the
legal system, and once more he was powerless to defend himself or do
the right thing for others.  He knew he was as shackled as poor Mrs.

Umlauf had been, and there was not a damned thing he could do about
it.

In fierce frustration he told Nora: "Call in the Umlaufs," and when
mother and son sat before him he had to tell them the shameful news:

"I'm powerless.  Your mother is no longer in our care.  Our hands are
tied until the court comes to a decision."

Silence fell, and then young Umlauf asked quietly: "Would you look the
other way if Mother and I took matters into our own hands?"

Andy did not reply, for he recognized this as a lure to trap him into
defending euthanasia, a step he could not take as a medical man who had
taken an oath to defend life at all stages and at all costs.  But as
the Umlaufs watched him fixedly he gradually saw quite clearly and
unequivocally the path that as a human being he must take.  Looking
straight into the eyes of first the mother and then the son he gritted
his teeth, said nothing and, turning his head sharply, looked out the
window.  They understood this, rightly, to mean that they had his tacit
support, that he would indeed look the other way.  As Andy watched the
resolute pair leave his office, he wished them well.

At a quarter to two that night, Gretchen Umlauf, in a flowing white
gown lent her by a friend at the Palms, was led by her son along a
route arranged by the same friend.  Easing her quietly into the
corridor, Victor watched his mother make her way silently to Room 312,
her mother-in-law's prison.  Protected from view and in the dim blue
light used to illuminate hospital rooms with an almost mystical glow,
Gretchen kissed the comatose old woman, then quickly removed one after
another of the life-support systems.  Finally, with a mighty pull, she
ripped out all the electrical attachments so they could not be quickly
reinstalled.  With alarms sounding throughout the Health building,
Gretchen quietly edged her way back to where her son waited.  They had
broken the law, but Berta Umlauf, who had unsuccessfully battled the
medical profession, the legal eagles, Hasslebrook's movement and the
entire state of Florida, finally won the right to die with dignity.

Dr.  Zorn and Betsy wanted to hold their wedding at the Palms, for this
was where their love had been discovered and had matured, but Oliver
Cawthorn was adamant that it be celebrated in Chattanooga, the town in
which the Cawthorns had been leading citizens since the foundation of
the place in 1835.  The family, a sprawling one with many aunts, had
feared that Betsy, after her accident, might never marry, so when she
found a young doctor, and a rather handsome one, it was doubly pleased.
All the Cawthorns clamorously supported Oliver's desire to have his
daughter married in one of the old Chattanooga churches.

So Betsy surrendered, and Zorn, though he preferred to have the
celebration at the Palms, complied with Father Cawthorn's request.

But when Cawthorn also nominated the clergyman who would perform the
marriage service, a well-known Baptist minister named Caw-thorn, he ran
into a wall.  Betsy said: "I want to be married by the minister who
gave me real spiritual assistance during my recuperation.  So don't
argue, Father, I insist."

He withdrew the nomination of his distant cousin Cawthorn, telling his
relatives: "I got my way on the church, let her have her way on the
minister," but when those in the community learned that the minister
Betsy preferred was a woman, Reverend Helen Quade, many exploded.  The
Southern churches had not been willing to welcome women in the
clergy-"What on earth do you call them?  Clergywomen?  That's pretty
repulsive'-and to have one, a stranger to boot, officiating at a
prominent society wedding was deplorable.

Betsy was as strong-willed as anyone in her family, but before forcing
the issue she had to be sure that Reverend Quade was willing to
participate in what might become a ticklish or even unpleasant family
dispute.  So she went to Mrs.  Quade and asked: "Would you be willing
to go to Chattanooga to officiate at our wedding?"

"I'd be honored.  I'm so happy for you and Andy."

"Even if it might mean some protest from the conservative wing against
a woman priest?"

Helen contemplated this: "Of course I'm aware that some of the local
clergymen might protest, an outsider and a woman taking over what I
suspect will be a society wedding.  But I'm a battle-scarred veteran in
such affairs and never loath to do what ought to be done."  She smiled
in memory of former skirmishes, then said firmly: "You and Andy are
certainly my dear friends.  Sure, I'll go and see this wonderful
courtship finished in style," and she accepted their offer to pay her
transportation and housing during the five days of festivities: "No
minister gets paid excessively, and female ones do not even reach
midpoint in the scale, restricted though it is.  Thank you."  Andy
explained that there would, of course, be the customary minister's fee,
and she replied: "Naturally."

Betsy, determined to solidify her decision to invite Reverend Quade,
asked the society columnist from a Chattanooga newspaper to fly down at
Betsy's expense to meet Reverend Quade and to write an account of the
latter's distinguished career.  The reporter quickly recognized Helen
Quade as an outstanding woman and was not afraid to say so in the
article she sent back to her paper.  At Betsy's insistence, it
contained six photographs of Reverend Quade in exotic lands and
receiving medals from various governments, including the United
States.

"In bringing Helen Quade to Chattanooga," the reporter summarized,
"Oliver Cawthorn is conferring honor on our city."

With that settled, strong-minded Betsy pursued her second major desire,
to have Nora Varney as a member of their wedding party.  Zorn approved
so enthusiastically that he wanted to be allowed to do the formal
inviting, and Betsy, aware of how important this superior black nurse
had been to Andy's success at the Palms, consented, but she too wanted
to be present when the invitation was given.

The meeting took place in the director's office with just the three
principals present, and Andy launched right into the subject: "Nora, as
you know, I wanted the wedding to be held here, among our friends.

But it made sense for Betsy's father to insist that it be held in
Chattanooga, where Betsy grew up and where the Cawthorns, hundreds of
them, have always lived.  So it'll be there, and we'd be happy if you'd
fly up with us as Betsy's matron of honor."

Nora, who may have anticipated such an invitation, had her answer
ready: "No, I love you both and wish you everlasting happiness, but I
can't go with you this time."

"Why not?"

"Because there's not a day goes by that my AIDS cases don't need me.  I
fled Jaqmeel's deathbed, but I'm not about to let anyone else I know
die alone.  But bring me a piece of the wedding cake."

Betsy had more luck with another invitation of great importance to her.
When she told Bedford Yancey she wanted him at her wedding, he cried:
"I was coming whether you invited me or not.  I'd have stood outside
and cheered when you walked past."

"Don't be silly.  Of course you'll be inside, a guest of honor."

"So now when I see you walking past, as I predicted you would, I'm
goin' to give a real Georgia yell: "She's done it!"  ' "No, Yancey. You
were free to bully me about when I needed it.  But my depression's
gone, and you keep your big mouth shut.  Just throw me a kiss," and she
kissed him.

The wedding was far more emotional than Dr.  Zorn had expected.

The local media, understandably, had given much play to the romantic
aspects of the love affair: The local girl, a fine athlete, almost cut
down in her prime' and "The Good Samaritan in the snow' and other
details concerning the couple.  The constant round of photographic
sessions and rehearsals with Betsy's friends who were to be in the
wedding party and the showers given by women related to the Cawthorns
took up much of the couple's time.  One afternoon, when they had a rare
few hours free, they decided together to make an important visit.

They rented a car and drove west out of Chattanooga to the spot on
Route 41 where the fateful New Year's Day pileup had occurred.  They
explored where they had both been that day, zeroing in on the specific
sites where Andy had careened into the ditch and on the spot above it
where the crash into Betsy's car had occurred.

It was awesome to see the scene where they had met, and in a sense to
relive the harrowing moments when the dead were hauled away by bloodied
workmen, the helicopters hovering like vultures.  They could almost
hear the sirens wailing.  In the sunlight at this dreadful spot they
embraced and sealed more securely than ever their mutual devotion as
Betsy whispered in his ear: "Here I died and here I was reborn."

When Clarence Hasslebrook, the fanatical officer of Life Is Sacred,
learned that his cause celebre, the old woman whose story had been in
all the newspapers and on the television screens, had managed to die
despite his efforts, he was certain that the infamous Umlauf clan had
been responsible.  He told the papers it was murder, pure and simple,
but he was unable to point to the one who had committed it.  As it
happened, he was thrown off the scent because two separate patients in
Extended Care swore that they saw an angel in flowing white garb fly
into Room 312, make a considerable noise there and fly out again, going
right through the far wall, where clearly there was no door or window.
Had the two old people been able to communicate with each other to
connive on such a yarn?  No, from widely separated beds, each had seen
the angel.  They agreed in their description.  And they were equally
certain that the angel had flown right through the wall.

The Umlaufs, in a final gesture of defiance, made arrangements to take
their mother back to the family plot in Michigan for burial.  Out of
respect for the memory of Noel's father, Ludwig, and his grandmother
Ingrid, who had worried so much about what the people back in Marquette
might think, they assured all the neighbors that Berta had died in an
expensive suite in a fine hospital.  What the neighbors thought that
cold December day of the burial was that Berta's children had given her
a very fine funeral.

Hasslebrook did not take his defeat easily.  Determined to have
revenge, but no longer able to intimidate the Umlaufs, he directed his
anger toward the Palms, and in particular toward Dr.  Zorn, whom he
suspected of having aided the Umlaufs.  He would take care of that
charlatan.

He started by visiting a man who he knew despised Zorn, Dr.

Velenius, the dentist in the suburb north of Tampa, and there Dr.

Velenius gave him a mix of fact and suspicion, all of it damning to the
director of the Palms: "We know he interfered in my relationship with a
patient.  Stuck his nose in where he wasn't wanted or needed.  I'm
convinced that in certain AIDS cases he's practicing medicine in
Florida without having been licensed in this state."

"We better lay off that one," Hasslebrook said.

"Wouldn't sound good, hammering a doctor because he helped with AIDS
patients."

"You're right.  But I'm certain that Zorn has willfully broken the law
by tempting otherwise legitimate dental technicians into mending plates
at half cost for residents of the Palms."

"Keep watching the scoundrel.  They didn't run him out of Chicago for
nothing."

In his passionate desire to discredit Zorn, Hasslebrook enlisted the
Illinois members of Life Is Sacred to track down the specific charges
for which Zorn had been disqualified by the Illinois medical
association.  When they reported that Zorn had never been thrown out of
the ranks and was still qualified to practice if he could pay the
soaring insurance premiums required in obstetrics, Hasslebrook asked
his Chicago associates to zero in on just what Zorn had done wrong in
the two lawsuits he had lost.  By intensive interrogation of five
people, the four parents who had brought accusations and the skilled
attorney who had assembled the evidence and tried the cases, they
accumulated a chain of such serious charges that it was a wonder to
them that Zorn had not been jailed.

But the really damaging evidence, the incriminating material that made
Hasslebrook almost salivate, was unearthed when he drove to a mean
section of Tampa, where on the second floor of a wretched rooming house
he interviewed the two photographers his organization had hired to make
a photographic record of the various flophouses, improvised hospital
arrangements and semirespectable hospices in which doomed men with AIDS
were being treated during the last stages of their affliction.  To
Hasslebrook's delight these tireless spies, the tall thin man and the
short dumpy woman, had accomplished even more than they had promised.

"We've caught these fine shots of Dr.

Zorn," the man said as his wife arranged the stills on a greasy
table.

"These show him entering and leaving places in which men died
mysteriously."

"Who's the big black woman with him?"

"Nora Varney, his nurse at the Palms.  She's obviously partners with
him in whatever illegal things he's doing."

"What's this group of shots, individual men not in very good focus?"

"They're the cream of the crop," the woman said.

"Positively prove that criminal activity has been going on."

The man took over: These are the men the newspapers talk about.

The agents of death.  Locals like the guy in Michigan.  This one-and I
wish it were in better focus-is famous.  The police really tried to
track him down.  This shot shows him at his best, in a black cloak, but
he's not Hispanic.  Borsalino hat, but he's not Italian either."

"Who is he?  What is he?  How does he affect our case against Zorn?"

"He's the man we can prove comes in near the end to help the AIDS men
commit suicide.  Totally illegal, cops everywhere want him."

"Could we possibly get in touch with him?"

"Seems to have left the area.  Or is working in a new costume.  Not
much chance."

"But we can relate him to Zorn?"

"Absolutely.  This shot and this one definitely tie him and Zorn to the
hospice run by the Angelottis on the day the big basketball player
killed himself."

"Would you be willing to testify to what you've been telling me?"

"We would.  We feel sure Dr.  Zorn has been mixed up in some filthy
business, him and the black woman.  Look, we have shots of him just
recently going into one of the worst places.  Men die in this one all
the time.  We have shots of bodies being taken out."

When Hasslebrook had his data assembled-the innuendos, the unattributed
accusations, the ugly stories out of Chicago and, above all, the
photographs that would look so damning in the press and on television
(and all of this collected and organized while he was living under Dr.
Zorn's care, as it were, at the Palms)-he placed a telephone call to
John Taggart.  When the Chicago financier came on the line Hasslebrook
immediately launched his offensive: "Am I speaking to the John Taggart
who operates the chain of retirement homes?... I believe you are the
owners-your organization, that is-of the fine installation in Tampa
known as the Palms?... Well, Mr.  Taggart, you don't know me but I'm an
officer of the national movement Life Is Sacred-' "I do indeed know
you.  I followed your accomplishments out west.

Your picture's been on the tube here in Chicago.  An amazing story.

You and the white angel.  What can I do for you?"

"It would be greatly to your advantage, Mr.  Taggart, if you flew down
here, let's say tomorrow, and talked with me.  I think it might protect
your considerable investment in nursing homes."

"Are you inviting me or ordering me?"

"You judge."

"And we never call them nursing homes."

"I do.  Yours are just more expensive.  Can I expect you-tomorrow?"

"I'll fly down and be at the Palms at ten o'clock."

"You can call me when you arrive.  The switchboard will have my number.
I'm staying at the Palms, you know."

"Yes, so I've been informed.  Hasta la vista, Brother Hasslebrook."

When Hasslebrook hung up he was not entirely at ease.  Taggart's
farewell seemed quite flippant, as if Taggart was more than prepared to
face any threat of blackmail or other intrusion into his lucrative
business.  So be it, Hasslebrook said to himself.  With that file over
there, I'm more than ready for you, John Taggart.

Next morning Taggart rose at six.  He grabbed a handful of dry granola,
hurried to the commercial airport where his corporate jet waited, flew
to Tampa International and was sitting in Dr.  Zorn's office at nine,
asking in a friendly manner: "Andy, what in hell happened down here?"
Zorn said briefly: "A wonderful woman eighty one years old wanted us to
execute her living will, which was defective.

This man Hasslebrook, an officer of Life Is Sacred, decided to make a
national case out of it.  Clever rascal, knows how to use the court
system and he tried to persuade a local judge to issue an order making
him the legal protector of the old lady, which would have meant that
the family would lose all control of their mother's care.  The woman
died before the court issued a decision."

"What was this about a floating white angel?"

"No one knows, but two different patients in Extended Care saw her
clearly and watched as she flew right through a solid wall.  They were
on different parts of the floor, and so there could have been no
collusion."

"What's this fellow up to, demanding that I fly down and talk with him
today?"

"He's taken a violent dislike to me, has been snooping around,
collecting rumors, I suppose."

"Your skirts clean?"

"I think so."

"What's this about the old woman being in a straitjacket, as the
daughter-in-law charged in that big press conference?  Surely that
never happened?"

"I'm afraid it did."

"Andy!  In one of our establishments?  Oh, what a terrible mistake!"

"An overzealous nurse."

"I hope you fired her."

"Hasslebrook wouldn't allow it.  Threatened an even bigger scandal if I
took any action against the nurse."

"Is she still with us?"

"Yes."

"What's she doing now, cat-o'-nine-tails if you spill your gruel?"

"Hasslebrook is one very tough customer.  A true believer with
all that zeal behind him."

At ten the local agent of Life Is Sacred entered the office, introduced
himself to Taggart and said bluntly: "This is private between the two
of us," and Taggart responded: "Dr.  Zorn is my resident director.  He
and I are a partnership."

"Then you've flown down here on a useless mission.  I'm leaving."  He
started for the door, whereupon Taggart had to say: "Andy, you'd better
leave us alone," and the doctor had to leave his own office.

When he was gone, Hasslebrook became conciliatory, almost as if he were
a prudent counselor striving to assist a friend: "I think you and I
have a problem with your Dr.  Zorn."

"How could that be?  What's he done to give you trouble?"

"It's your problem, principally.  You and your eighty-seven nursing
homes.  They could be in real jeopardy-if you allow Dr.  Zorn to remain
on your payroll."

"Are you advising me to get rid of him?  After he's done such wonders
here?  Turned the place around?"

"It would certainly be to your advantage to get a bad apple out of your
basket."

"That's a rather sweeping condemnation, delivered with no proof."

"Proof is what I invited you down to see," and Hasslebrook opened his
bag and began spreading the photographs in neat groups: "I want you to
study these with me, and see the kind of man you've sent to Florida,"
and he moved from pile to pile, spreading each batch before Taggart as
he spoke: "Here you see your doctor meddling in one of the worst AIDS
refuges in Tampa, a real sink.  And you'll notice he's taking his big
nurse with him.  What's he doing?  Helping the men commit suicide."

"How can you accuse him of that?"

"Because that's what happens there.  Because that's why he goes there.
And even if he doesn't actually assist in their suicides, he's
certainly practicing medicine without being licensed to do so in
Florida.  But these next photos nail down his complicity.  This strange
looking fellow, a modern Zorro, is the famous Angel of Death you've
read about, known for helping AIDS patients commit suicide, or doing it
for them, we believe.  Here he goes into a refuge, Zorn coming along
later.  Here he is leaving the same house, Zorn exiting later. And the
big nurse is waiting in the car."

On and on went his analysis of the photographs his two spies had taken:
The shots of the Angel of Death aren't so clear because he came and
went in a hurry, and if he saw us he turned his face away.  But it's
him on his evil business."

By the end of his lecture, which included a rehash of the suspicions
raised by Dr.  Velenius and the informants in Chicago, Hasslebrook had
painted a devastating portrait of a medical doctor run amok, ignoring
the laws of the state and threatening the reputation of not only the
Palms but all eighty-six of the other Taggart centers.

"Why haven't you brought a court action?"

"Because that Zorn's a wily one.  He covers his tracks, but the boom is
about to be lowered, Mr.  Taggart.  I'm thinking of going public with
my charges against your man.  With the full force of my organization,
we can gain national publicity.  I'm thinking of using events here at
the Palms in which he broke every rule in the book-' John Taggart,
veteran of a score of lawsuits about zoning restrictions, spoliation of
natural sites and details of construction contracts, had learned that
whenever a man of shady character used the phrase I'm thinking of,"
what he was thinking of was blackmail in one sophisticated, almost
legal form or another.  Taggart's problem was to ascertain how much the
blackmail would cost.

When Hasslebrook saw his target pausing to reflect, he guessed
correctly that the Chicagoan was trying to estimate how much he and the
Life Is Sacred gang could hurt him, and on that delicate point
Hasslebrook was more than prepared: "What I shall do unless corrective
steps are taken is launch a campaign here in the Tampa area-and I have
access to all the media, they know me-in which I will lay out the
misbehavior of your people in what you call Extended Care, but which
everyone else knows to be a hospice, and I shall describe it as Murder
Mansion."  He stopped, seemed to roll the words around in his mouth as
if savoring the dire implications.

"Murder Mansion.  A name like that might stick, and if applied to your
entire chain it might do considerable damage, especially in areas where
religion is taken more seriously than in the playgrounds of southern
Florida."

It was an ingenious threat and not an idle one, for such a phrase,

once applied to an entity of any kind, could have harsh negative
repercussions and, in the case of a health-care facility, they could be
devastating.  Taggart had to weigh with extreme care the degree to
which Hasslebrook's threat was enforceable, and the premier fact was
that the man's parent organization had a most compelling name, Life Is
Sacred.  No one challenged lightly an organization like that, backed as
it would be by a thousand churches.  Had the outfit carried an accurate
name like Snoops of the World or The Gang That Tells You How to Live,
they could be rebutted, but it was never fruitful to tackle the God
Squad.  They could enlist too much ardent support.  So it was
obligatory that Taggart not enrage this man or in any way underestimate
him.

"Let's get to the bottom of this, Mr.  Hasslebrook.  You seem to be a
reasonable man, strong in your own opinions and affiliated with a
powerful organization.  I don't fully understand why you chose to come
to the Palms.  Please explain."

Hasslebrook, mistakenly supposing that the health magnate was willing
to dicker, wanted to make his case as easily understood as possible:
"Quite simple, sir.  Our national organization decided to target the
Palms and its loose administration.  My board dispatched me here to
monitor the operations of your Extended Care facility.  Rumor had it
that like many institutions you were allowing very liberal
interpretations of living wills and we were determined to halt such
activity."

Hasslebrook was so mesmerized by what he assumed would be an easy
triumph for him that he failed to see that Taggart's jaw muscles were
practically standing out from his face, so grimly did he take this
almost amateurish attempt to blackmail him.  He had not become master
of a nationwide operation without having faced numerous opponents
determined to prevent him from doing what he saw was both right and
legal.  But he had won his fights by being reasonable, by listening to
his opposition, and by reaching a solution that allowed his adversaries
to save face when possible.

He now reverted to that time-tested strategy: "I have great respect for
the basic motives of your organization, Mr.  Hasslebrook.  Old people
need and deserve protection.  But, I repeat, why did you target the
Palms?"

"Simple," Hasslebrook explained, rather proud of his tactics.

"We find it best to attack the best.  Gives us more media."  He paused
ominously, then added: "Besides, you are a massive target-you have
nursing homes everywhere."

"We never use that phrase."

"We do," and for a moment it seemed the two men had reached an impasse,
but then Taggart proved his wiliness.  He asked calmly: Tell me, Mr.
Hasslebrook, how did Dr.  Zorn become so distasteful to you?

What did he do wrong?"

"He was basically in favor of the living will, liberally viewed.  He
advocated an easy interpretation of it on your third floor.  He was a
radical in his thinking about medical matters.  And he opposed me in
practically everything I wanted to do."

"Didn't you think such a reaction likely, when you slipped in here as a
kind of industrial spy?"

"Monitor.  To supervise adherence to the law.  To serve as the
protector of the aged who might otherwise be shuffled off to their
deaths."

"And you centered on Zorn as the official who might interfere with your
plans?  Because he might honor the legitimate living wills?"

"Yes.  He was the enemy and he proved it."

Taggart knew that now was the time to encourage Hasslebrook to reveal
his strategy: "So what do you want me to do?"

"I want you to fire Dr.  Zorn.  Get him off these premises."  Before
Taggart could respond, he added: "And don't transfer him to one of your
other centers, because we'll track him there.  The man's a killer and
our society demands that he be outlawed."

Taggart was shocked by the arrogance of this demand, but also by its
ramifications.  If he surrendered to Life Is Sacred in this first
confrontation he could see them demanding that all his centers ban the
execution of legal living wills, and that demand, if made, he could not
agree to.  But to fire a young man as capable as Andy Zorn, especially
since he had just married under emotional circumstances, was repugnant.
Hasslebrook, sensing something of this in the long silence, helped the
Chicagoan to make up his mind: "We will stigmatize your entire chain
with the name Murder Mansions."

In search of a rational explanation, Taggart asked: "Why are you doing
this?  What do you get out of it?"

"The satisfaction that we're protecting human life from the murderers
who would corrupt our society, to keep America from going the way
Hitler's Germany did," and he said these words with such profound
conviction that Taggart drew back and stared at him.

"You really believe that, don't you?"  and Hasslebrook replied:
"Yes."

When Taggart asked: "So this fight could be maintained against us
permanently?"  he replied: "Yes.  Wherever he hides, if it involves
health services we'll be there to expose him."

John Taggart had heard enough.  Leaning forward and fixing his eyes on
his visitor he said in a low, steely voice seething with contempt:

"Hasslebrook, you're a cheap, pitiful blackmailer.  Men like you grab
hold of a worthy cause and put it to unworthy purposes.  No, don't
interrupt.  It's time you heard this.  You've declared war against a
fine young doctor, and every charge you make is spurious.  Zorn's
supervision of our Extended Care facility has been impeccable.  He has
never urged euthanasia, only tried to respect the law.  He's never
interfered with operations there, as the presence of at least three
elderly patients attests.

And as you well know, we've kept Mrs.  Carlson mechanically alive for
over two years."

"But he wants to authorize execution of living wills."

"Only when they conform in every detail with the new Florida laws.

So to satisfy your personal lust for vengeance, you would destroy one
of the ablest, most compassionate young men in our system?"

"That's our demand."

"Not your organization's.  Yours personally."  Striding to the door, he
opened it and shouted: "Krenek, come in here!"  and when the assistant
appeared, Taggart said almost brutally: "Ken, I want this miserable SOB
off these premises by nightfall.  Pay him any refund to which he's
entitled and find him quarters in town as good as what he has here, but
at a lower price."

"If you try to throw me out of the Palms I'll sue you in every court in
the land.  All sorts of laws will support me."

Taggart smiled and pulled out of his breast pocket a tiny recording
device: "Mr.  Hasslebrook, I doubt you'll be heading for any courtroom
unless I decide to drag you there."  He smiled broadly, tapped the
ingenious machine and said: "The Sony people in Tokyo are to be
commended.  They invented this little box, a scientific marvel.  It
contains a powerful microphone that can record even whispers in a room,
every syllable, loud and clear.  Ken, fetch Dr.  Zorn and Nora.  I want
witnesses."

When the group was assembled, Taggart activated the rewind button and
out of the little box came the whining voice of Clarence Hasslebrook as
clearly audible as if he were again saying the words that condemned
him: "I want you to fire Dr.  Zorn.  Get him off these premises.  And
don't transfer him to one of your other centers, because we'll track
him there.  The man's a killer and our society insists that he be
outlawed."

Ashen-faced, Hasslebrook cried: That's illegal.  The law says you can't
tape a conversation without warning the speaker."

"Yes, it is illegal.  But when it's used to uncover a greater
illegality it can achieve its purpose.  Imagine a transcript being
handed to the newspapers."  In the silence that followed, each person
in the room visualized the effect of such a release on Hasslebrook and
his organization's reputation and mode of operation.  Quietly Taggart
advised: "So I think, Mr.  Hasslebrook, that you'd better scurry out of
here and surrender in your fight against Dr.  Zorn," and he turned the
blackmailer over to Ken Krenek.

When Taggart and Zorn were left alone, Andy reached a momentous
decision, which he reported immediately to his boss: "Mr.  Taggart, I
quit."

"Quit what?  Smoking?"

"My job here at the Palms."

Taggart was aghast: "You're one of the best directors we've ever had.

How could you have such a silly idea?"

Two very strong reasons.  First, I can't allow you to keep me on if it
means endless warfare with Hasslebrook and his committee."

"Andy, I've shown how we handle a jerk like that.  Throw him out and
dare him to challenge us in the courts."

"But I heard his threat on the tape: "Wherever he hides, if it involves
health services, we'll be there to expose him."  That's ominous." After
attempting a wan smile, he added: "But my second reason is the real
one.  I want to be a full-fledged doctor again, not an administrator of
health services in which other doctors do the healing and I do the
paperwork."

"A passing regret.  Here at the Palms you've found your true calling.

These people love you.  There's no limit to the heights to which you
can rise with us.  I can't remain in control forever."

"I've been looking through the medical journals-where communities
advertise for doctors to move into their areas-' "Those ads are for men
ten years younger than you, Andy.  Throw away those boyhood dreams and
get down to your life's work."  He reflected for a moment, then said:
"We've been thinking of moving you to Southern California, whip our
centers there into the kind of productivity you've achieved here."

"Too late.  I'm on another track.  The one for which I trained."

"You really mean that, don't you?  You've allowed Hasslebrook to scare
you?"  Before Andy could respond, the battle-scarred veteran looked at
the ceiling and said: "Andy, I've had to fight the Hasslebrooks of this
world, endlessly.  You must do the same, and the place to start is with
our organization.  Will you take the California job?"

"No."

Taggart started to make several points but did not finish.  Instead he
said: "I think we ought to inform Mrs.  Zorn of this startling
development," and he called for Krenek to bring Betsy to the meeting.

When she arrived, walking awkwardly but without a cane, he told her:

"Your husband has quit his job with us."  He expected her to protest,
perhaps tearfully, but she smiled, reached for Andy's hand and said:

"I'm not surprised.  He's been talking that way for some time-even
writing to distant communities that were searching for a doctor."

"But he also refused a grand new job I offered him-in Southern
California-our holdings there."

"No, Andy's gone far past the stage of managing health services.  He
wants to participate actively in dispensing them, and I agree."

"But he'll never make the income in some backwater community that he
already earns with us, and in California that fee could be doubled."

"Andy wants to be a self-respecting doctor, and as for fees, my mother
left me a small trust-its interest will enable us to live decently,
even comfortably.  So I support his decision."

Taggart stared at this strong-willed woman, tapped the desk and said:
"You're as crazy as he is.  All I can do is wish you both the best of
luck."

"My good luck started when I insisted on moving down here from
Chattanooga.  Nurse Nora and that wild Georgian Yancey saved my life,
and I became Mrs.  Andy Zorn."

"Well, we still have to run this place," the tycoon said.

"Better assemble the staff."

"We must start with Nurse Varney," Andy said.

"She's the one who does the work."  When she entered the office she was
not aware of who the visitor was.

"Nora, this is John Taggart, head of our chain.  Mr.  Taggart, this is
Nurse Varney, the guiding spirit of our operation."  As the two shook
hands, Andy said: "For a variety of reasons, none of which dishonors
anyone, I'm leaving the Palms."

"Where you going?"

"I don't know yet.  Some small town-to be a doctor again."

The big nurse smiled at a decision she supported, but tears also came
to her eyes.

"I hate to see you go.  People need you here, Andy."  And then she made
an unfortunate statement that altered the tone of the meeting: "Dr.
Leitonen won't be able to get along with you gone."

"Who's he?"  Taggart asked, and she made matters worse by explaining:

"He's the Swedish doctor, the only one with the courage to care for
young men dying of AIDS."

Both Betsy and Andy could see Taggart freeze at the injection of that
word into the discussion.  Coldly the tycoon said: "Then Hasslebrook's
photographs were right.  You have been mixed up with that, too?"  He
did not try to conceal his intense distaste, and all that Andy could
say was: "He's not Swedish, he's Finnish."

Taggart did not reply.  He was thinking: I've proved I could protect
both the centers and Zorn from the evil attacks of Hasslebrook.  But if
AIDS was associated publicly with our centers, the damage might be
irreparable-to everybody.  Reluctantly he looked at the newly married
couple and said: "Maybe it's for the best," and Andy's resignation was
accepted.

On a cold midnight in mid-December the Duchess was awakened from a
restless sleep at some time past twelve by a noise that sent a chill
down her spine.  It sounded as if someone was quietly parking his car
in the space on the oval that had always belonged to her, and she
reacted with anger.  It was not only the trespass that annoyed her.
She'd had some difficulty with her Bentley and had asked the local
garage if they could send a man to take it away, on the twice-repeated
understanding that he would have it back by eight the next morning, for
she had planned to visit friends in Tampa before nine.  If the garage
man arrived to find her parking space occupied, there might have to be
some telephoning back and forth with the possibility the Bentley would
be taken back to the garage.  And then what?

Rising from her bed and peeking out her front window; she saw that her
suspicion was correct.  A dark-colored Chevrolet with no visible front
license plate now filled her space, and with no one in the driver's
seat it was apparent that it was supposed to remain there all night.
She put on a peignoir over her nightgown, then a loose coat with big
pockets, with the intention of going out to take down the number of the
interloper.  Before quitting her apartment she tucked into her pocket a
six-shot revolver she used on such missions.  She had found it a highly
effective scare tactic.  Outside on the oval's driveway while she was
busy writing down the car's license number, she heard what sounded to
her like loud dull thumps, which seemed to come not from inside
Gateways but from some point well outside the wall, perhaps toward the
river.

Mystified by the sound, she stuck her right hand into her pocket,
grasped her revolver and readied it for action by cocking it while it
was still in her pocket.  Then, gingerly, for apparently no one else
had heard the noise, she headed for the entrance and back to her
apartment.  But as she entered the hallway she found herself
face-to-face with two swarthy men running directly at her.  In that
instant she knew that they had been up to some mischief in Gateways,
and almost automatically she whipped out her gun and confronted them
before they could dash past her.  The man in front, the bigger of the
two, seeing her revolver, reached for his own but she fired first,
hitting him right above the heart and tearing a big, bloody wound in
his chest.  Dropping immediately at her feet, he had no chance to fire
his gun.

His partner tried to brush past her, and with a blow of his left arm
knocked her against the wall, but while she was falling back she
managed to fire two more shots at the fleeing body and was sure that
one of them must have hit him in the rear.

Although knocked to the floor and stunned by what had happened in those
few brief seconds, she began bellowing for help in a stentorian voice:
"Don't worry about me!  Get that bastard who ran out the door!"

And since the shooting had awakened almost everyone in Gateways, many
people ran past her as she lay there, directing traffic with a waving
revolver.  When she heard the screech of wheels she shouted:

"Damn it, he got away!"  And when Dr.  Zorn finally reached her with
Mr.  Krenek at his side, she told them: "He won't get far.  I'm sure I
hit him in the back."

"How can you be sure?"  Andy asked and she said: "Because I don't miss.
Not from that distance," and it was she who led them out to the oval
and discovered, with the aid of Krenek's flashlight, the thin trail of
blood that led to where the Chevrolet had been parked.  She still had
its license number in her pocket, and by the time everyone piled back
into the halls, the Tampa police were already broadcasting descriptions
of the fugitive car to police stations in the area and even those up
toward the Georgia border.

While the bloody body in the hall was being dragged away, people began
to ask: "What were they doing in this place?"  and a roll call was made
of the various halls.  Three couples had slept through the whole
affair, and when their apartments were checked, the only residents not
accounted for were the Jimenez couple.  Mr.  Krenek was sent with keys
to check them out, and soon even residents far removed from the
fourth-floor apartment in which the couple from Colombia lived heard a
man's terrifying scream.  When they rushed to the fourth floor and
crowded into the rooms where Krenek waited, ashen-faced, they saw that
Raiil Jimenez and his wife, Felicita, had been murdered.  The Duchess,
elbowing her way into the room, said: "It was a gun I heard.

Soft echo from a silencer," and for the first time, there in the
crowded room beside the two dead bodies, she told of hearing the
strange car moving into her parking place, of how she grabbed her
revolver and went out to jot down the car's license number and its
color, and then of how she ran right into the two killers, shooting one
of them before he could shoot her.  She ended her report: The second
man got away, but he won't go far, because I'm sure I hit him in the
back.  He may be dying right now."

As soon as Krenek heard the story, he asked: "Did you say swarthy?"

"Yes."

"But not black?"

"Definitely not."

On this scant evidence he concluded, and as it turned out rightly, that
the two strangers were a hit team sent up by Colombian cocaine runners
to murder Jimenez, the former Bogota editor who had hounded them so
relentlessly, even from his sanctuary in Florida.  And when the Tampa
police arrived, with members of the FBI following soon thereafter, that
was the hypothesis Krenek gave them.

The morning news reports in both papers and television were careful to
state that local speculation was that it had been a revenge killing by
the Colombian cartel, but there was no hesitation in publicizing the
amazing bravery of Mrs.  Francine Elmore, known throughout the Palms as
the Duchess.

"Alone, and armed only with a revolver her dead husband had given her
for protection, she faced two hoodlums unafraid, killed one and
wounded, perhaps mortally, the other."  Flash pictures showed her in
her French peignoir, heavy hunting coat and bedroom slippers.  Much was
made of her confident quote: "He won't get far.  I'm sure I hit him in
the back."

Actually, the second killer got quite far, speeding through the night
north to the Georgia border.  At dawn he had heard news of the killing
on the car radio, and although he was safely out of Florida, he began
to wonder whether he could possibly escape any farther because of the
pain radiating out of his left hip, into which a bullet had lodged.  He
was losing a considerable amount of blood.

Driving into a small town south of Macon, he asked in a drugstore that
had just opened: "Where can I find a doctor?  Bad pain in my left hip."
The druggist directed him to the emergency room of the little hospital
nearby, then noticed a faint trail of blood along the floor where the
customer had walked.  Saying nothing to his clerk, an excitable young
woman, he retreated quietly to his back office, dialed the police
department and told the answering officer: "This is Forsby.  Yes,
Nathaniel.  You'd better hurry over to the local hospital.  Best if
two, three men go well armed.  It could be the killer they were
broadcasting about.  Yep.  He looked Hispanic."

At the hospital the doctor who'd had the night duty was preparing to go
home for some sleep when the man came in with blood trickling from his
left hip and in obvious pain, but since there was no clear sign that a
bullet had caused the damage he saw no reason to inform the police, as
he would have had to do if it had been an obvious bullet wound.  But
when the wounded man was stretched out on the bed, his street clothes
still on, three police officers quietly moved into the next room and
sent a nurse in to tell the night doctor that the patient down the hall
was undergoing a cardiac arrest, whereupon the doctor said to his new
patient: "Ill be right back.  There's an emergency."

Something about the way the nurse behaved or the ominous silence
alerted the wounded man to danger, and he deftly withdrew his gun from
his pants pocket.  When the three policemen burst into his room, there
was a crashing echo of gunfire which left the Colombian gunman dead and
one of the policemen seriously wounded.

At that moment at the Palms the Reverend Quade was leading prayers for
the two much-loved Colombian patriots.

"They were," she said, 'heroes in the fight for liberty and decency in
their country and exemplars of Christian charity in their American
refuge.  It was the insidious arm of criminal revenge that hunted them
down, and their death is a loss to us all.  They had come here, like
all the rest of us, to find peaceful days in which to end their lives.
They could not have anticipated that they would die in this brutal
manner.  May their souls rest in that heaven which they tried their
best to bring into being here on earth."

When the short service ended with much weeping, three television
cameras from the networks waited outside to photograph and interview
the Duchess.  She looked impressive, standing erect with camera lights
framing her silver-haired head.  But her confident pose was shortlived,
for when what had happened since midnight sank in all of a sudden she
was powerless to speak, so Andy and Nora led her quietly away.  Krenek,
who had witnessed much of what had happened and who had played a major
role in identifying the probable background of the killers, substituted
for her and gave a thrilling account of her bravery and foresight.

"She even took down the license number of the car."

At that moment, as the interview ended, word was received by the
television people in contact with their home offices that the second
cocaine runner had died in a shoot-out in a small Georgia hospital.

When the Duchess heard the news, her voice returned and she cried
triumphantly: "I told you I hit him in the ass!  I don't miss."

When the turmoil over the murder of the Jimenez couple subsided, the
federal agents having made their interrogations and departed, Reverend
Quade, at the request of the residents, conducted a memorial service
one evening after dinner.  Her words were so apt that Mr.

Krenek had them printed in a small brochure, which contained
photographs of these two much-loved citizens:

Raul and Felicita came to us as refugees from a dreadful tyranny which
they had opposed with their courage, the loss of their property and the
sacrifice of the high position they had held at home.  In the very
appropriate phrase I heard once in Missouri, "They voted with their
feet," and found a good life in our country.  With a degree of love
hard to match, they managed to keep their family together, bringing
members to our home here each year and with enormous difficulty.  We
knew their children and grandchildren as if they were our own, and they
taught us the meaning of the words love and family solidarity and
Christian values.

They died in the midst of the battle they had bravely taken upon
themselves.  They fought our struggles for us, and all who knew them
well are indebted to them.  We see him now, still among us, Raul, tall,
slim, urbane, a Spanish nobleman from another century, Felicita, the
bubbling extrovert who could never allow herself to be dispirited.
Listen, she is laughing with us once again!

How steadily in Gateways, our lovely, comforting home, are we forced to
face up to the word death, but we do not want our days to be ended in
hideous disease, tragic loss of mind or cruel murder.  The actions of
those gunmen, tracking down a man and his wife through two nations and
across two oceans was brutal and inhumane, but such death is also a
part of life.  Raul and Felicita knew this when they chose to speak out
for decency and freedom.  I shall remember him playing bridge and
glaring at me when, as his partner, I made what he considered a stupid
error.  I remember her as she knocked on my door with an offering of
Toll-House cookies that she had baked for her neighbors.

God give us the strength to carry on the good life in the many ways
that they did and may we join them later in a more peaceful
afterlife.

The morning after the memorial service Dr.  Zorn disappeared for three
days without informing even his new wife of where he was going, whom he
was meeting or what he was doing.  Krenek and Nora supposed that he had
gone to Chicago to report to Mr.  Taggart on the aftermath of the
murders, but when the head office called the Palms to ask about that
very problem it became evident that Andy was not there, nor had he
been.  Krenek assured Nora and Betsy that Andy had been in reasonably
good spirits despite his recent resignation and he guessed: "I'd say he
was out looking for a new job, maybe even interviewing, and he didn't
want to raise your hopes only to have them dashed if he didn't find
employment."

On the fourth day Andy flew into Tampa International on a red-eye
express from the west and immediately met in his office with Betsy,
Nora and Krenek.  After embracing his wife and apologizing, he took
from his briefcase a substantial collection of pamphlets, posters and
maps.

"I apologize to all of you, especially Betsy, but I have serious
problems to grapple with these days and I thought it best to fight this
one alone."

Shuffling among his papers, he found a medical journal in whose pages
he faithfully followed recent developments in his profession, even
though he was no longer a practicing physician.  Turning to a page
marked with a paper clip, he placed the magazine facedown and said: "I
suspect Clarence Hasslebrook may have done me a favor in forcing me to
leave this comfortable job.  Betsy and I could have remained here and
built a good life for ourselves and, I believe, for the residents in
our care."  He paused, then said slowly and with profound conviction:

"But I want to be a doctor of medicine.  I want to care for patients
who need my assistance and knowledge.  My work with Nora and Dr.

Leitonen has shown me the path of duty.  My visits to our

Alzheimer's patients remind me of the obligations of doctors.  And when
I stop by that horrible room holding Mrs.  Carlson, I am torn apart by
the question of what proper medical care is.  I am a doctor.

I'm not the manager of a posh hotel."

His listeners understood the depth of his conviction and the steps by
which he had decided to return to his permanent calling, but they had
not a clue as to what secret steps he had taken to reenter his
profession, but now he held the magazine with a finger marking the page
he wanted and explained: "When I was forced to consider what I wished
to do with the remainder of my life, I started reading the want ads in
the medical journals-you know, the ones in which small towns in the
hinterland advertise for a doctor to help them, and I stumbled upon
just what I was looking for."  He opened the journal, pointed to a
small ad outlined in red ink, and passed it around.  It said, in part,
"Silver Butte, a town of 1,800 on the glorious Madison River in south
Montana near Yellowstone Park, seeks a doctor.  Free office space for
one year, loan of a car, gasoline at a discount, and other perquisites.
Finest landscape in America, mild winters."

"Is that where you've been?"  Betsy asked without betraying her
response to his revelation.

"Yep.  Flew out to Billings, was met by a committee of the finest
townsmen and -women ever, and rode with them over fascinating back
roads to their town of Silver Butte.  They made it clear before we got
there that the settlement had been named in the last century in hopes
there'd be silver.  There wasn't."

"Did it look feasible?"  Betsy asked.

"For my purposes, yes."

"Exactly what are your purposes?"  Krenek asked, and he replied: "To be
a doctor.  To run the whole gamut.  Building a small hospital. Bringing
some young medical resident in to help me establish a county wide
network.  And to treat every sick person who can find the path to my
door."  He stopped, then clarified his dream: "To be the kind of doctor
I imagined I'd be when I started out years ago in Illinois."

Nora asked: "Is there a hospital of any kind in the area?"

"There's a small building they've been using as a first-aid center.

Good hospitals in Bozeman, fifty-two miles away, and Butte, sixty one
with helicopter services in the area.  And absolutely first-class
facilities in Billings, Montana."

"Any other doctors in the vicinity?"  Nora asked.

Two older men in towns rather distant, but each of them is thinking of
quitting."

"Did the community look as if it could ... I guess I mean'-Krenek
fumbled-'did it sound as if it could support a doctor?  What do your
medical associations recommend as the minimum population to support one
doctor?"

"Comes in, I think, at about twenty-four hundred."

"And this Silver Butte has eighteen hundred?  Does that mean the doctor
starves?"

"It means, I think, that a good doctor can use that as a base and build
a clientele."

Now Betsy spoke: "Is the Madison as attractive a river as they said?"

and he turned to the rest of his publications and showed her the great
prairies reaching out from the Madison, the nearby peaks of Yellowstone
Park, all depicting the West at its best.  Shrewd Nora observed:

"All taken in the midsummer, I'll bet.  You have any shots taken in
winter?"

Andy looked at his nurse and said: "I was about to ask you if you
thought you could hack it because if I go I'll want you to come with
me."

"More better, I think," Nora said with a wide smile, 'that you ask your
wife first.  Can she hack it?  No amputee specialists in Silver Butte,
I'll bet."

Andy looked at his wife, not pleadingly but eager to hear her response
before he had an opportunity to defend his tentative decision to move
out to Montana.  She thought some moments, then said: "I think a
doctor's going to be more important in my case than an amputee wizard.
What I'm really going to need is a reliable obstetrician.  But then
again, I married one."

The three others in the room stared at her in amazement, and when no
one spoke, she added: "Dr.  Farquhar was sure I was pregnant, but he
sent me to a specialist who ran tests.  There's no doubt."  Then she
poked her husband in the arm and said: "So while you were keeping
secrets from me in Montana, I was having my secrets from you here at
the Palms."

"A baby-that's wonderful!  But that does change things," Andy said,

visualizing an entire constellation of new problems, but Betsy eased
his mind at least temporarily by asking: "How big is Butte?"

"About forty thousand."

"It'll have a decent hospital, I'm sure.  I think it could be
handled."

Andy spread maps of Wyoming and the American West before them, and
showed them how the Madison River began almost in Yellowstone, then ran
north to join the Jefferson and Gallatin rivers before they became
headwaters of the great Missouri River which flowed for more than two
thousand six hundred miles before it joined the even greater
Mississippi.  As his finger traced this tremendous river system, one of
the glories of North America, his three listeners could see that he was
truly enamored of the idea of moving west and becoming part of that
majestic section of America.

They spent some time studying the printed materials and trying to see
what Silver Butte was like, but none of the colored shots in the
expensive brochures created any real sense of the remote frontier
town.

However, Andy had borrowed a camera from the local druggist, who had
been one of the welcoming committee, and with two rolls of film he had
captured the essence of what might become his and Betsy's future home.
When the seventy-two photographs were spread on the desktop, they
presented an honest portrait of a small Montana town, and it was not
entirely inviting.  Nora asked: "What building was it you said they
used as a kind of first-aid station?"  and he pointed to a stonewalled
structure that he had inspected, where the druggist kept oxygen, a
respirator, ammonia for shock and a shelf of standard medications, none
requiring a doctor's prescription.  Near this building there was a
level place for a helicopter to land.  But no matter how forgiving one
was in surrendering to historical nostalgia, Silver Butte was clearly
not in the mainstream of the modern world.

A decision to move west was of such importance that Zorn decided to
consult with Dr.  Farquhar, who was near at hand, and he wished that
down-to-earth Dr.  Zembright were close by and not up in Chattanooga.

Farquhar was pleased to talk and quickly put the problem of moving in
its proper perspective: "If you were twenty-six I'd advise against it,
for the moment.  At that age a young man profits enormously from having
older physicians in the area to talk with, to consult with on difficult
cases.  You learn by listening.  But at your age, already having had
the benefit of talking with your elders, you have a store of knowledge
to build on.  If you feel strongly inclined, and they'll give you the
perquisites to help you get solidly started, I'd say go for it.

"But I can assure you of one thing, Andy.  I've known for some time
that you wanted to get back into real doctoring.  The way you've worked
with Leitonen.  Yes, we other doctors heard about it and applauded.  We
wanted to do what you did but hadn't the courage.

And your intense interest in your Alzheimer's cases.  I could see it,
and even your Nora-bless that woman's heart, it's a big one-told me you
were ready to go back to the real job.

"You've completed your task with us at the Palms.  With Krenek staying
on, and some good younger man coming aboard, we'll take care of
ourselves.  I'm optimistic about the Palms and thank you for your help.
Keep in touch when you get settled in Montana, and make friends with
all the doctors in your area, no matter how far apart they are."

Reassured by such talk, Andy was inclined to send the people at Silver
Butte a firm acceptance, but he was not yet sure of Betsy's honest
opinions.  That she was pregnant there was no doubt, and it was obvious
that she was a heroic woman, but the shift from tropical Florida to
Montana was so vast that he was uncertain as to whether she could
manage it.  In the meantime she studied the literature on the place and
daydreamed over the big maps and step by step resolved each of her
doubts.

One day as Christmas approached she greeted Andy with a broad smile
when he returned to their apartment for lunch: "About an hour ago I
visualized all our problems clearing up.  Montana, here we come!

Andy Zorn, you're to be a real doctor again," and their mutual
anxieties evaporated.

The radical move to Montana did not occur because of a stunning
counteroffer that came from Chattanooga.

When Oliver Cawthorn and his influential friends in that city learned
that Dr.  Zorn had surrendered his position at the Palms, they
accelerated plans for a project they had been seriously contemplating
ever since Betsy went to Florida.  Putting architects and draftsmen on
overtime, they now had in their possession precise plans for a major
effort.  Cawthorn assembled the other four major participants in the
venture-Dr.  Zembright the medical expert, Chester Bingham the builder,
Lawrence Desmond the real estate investor, and Charles Oilman the
lawyer and financier-and they flew to Tampa in their private jet and,
hiring a car, sped out to the Palms.  They summoned the Zorns and
cleared the big table in the office Andy-would soon be vacating.  On it
they spread an aerial photograph of wooded and mountainous land on
which red-inked lines had been drawn showing the plots of land they had
recently purchased.

Chester Bingham began to speak: "We were fortunate in being able to
start with five hundred acres of choice land that Desmond already
owned.  Show them where it is, Desmond," and the proud owner traced his
land, explaining as we went: "This fine mountain land over here
abutting mine to the east is the Great Smoky Mountains National Park,
preserved forever, but more or less available to use for nature trails
and so on.  Chester, you carry on."

"So, the rest of us, with that beginning, banded together to buy about
eight hundred additional contiguous acres here, here and here."

Mr.  Cawthorn broke in: "So we have thirteen hundred acres of
Tennessee's best native woodland, no building of any kind.  We'll have
a free hand."

Bingham made an interesting point: "Because we're protected here on
this side by the park, what we'll do is leave undeveloped any of the
acreage that touches anyone else's.  A wilderness, ideal for what we
have in mind."

"Which is what?"  Andy asked, and Bingham flipped away the land plat to
reveal an architect's handsome rendition of a segment of the holding
showing a nest of buildings at the top, a lake in the middle and two
mountains at the bottom, a small one to the west, a big double crested
one on the east.  Ample space was indicated everywhere.

"A

wilderness of beauty for everything we have in mind," Bingham said,
'and enough room."

"But the buildings?"  Zorn asked, and Dr.  Zembright said proudly: "A
state-of-the-art retirement complex," and under the guidance of his
forefinger the Zorns saw the outlines of an ideal center: the three
major buildings were properly ranged in an arc; three walks were
sketched in, a relatively short stroll down to one bank of the lake, a
longer circuit of the lake, and a rugged trail of some distance up and
down along the edges of the mountains; plus a feature that proved to
Andy that the men had had good advice: in the flatlands near the three
buildings was a series of detached private homes and duplexes for
couples who wanted to live in their own homes as long as possible
before entering the retirement condominiums.

"Are you men prepared to build such an establishment?"

"We're already partially subscribed," Bingham said.

"But we'd have been willing to put up the cash ourselves, if we had
to."

Desmond, the owner of the major portion of the land, said: "More people
than you'd think, Dr.  Zorn, are seriously considering how they want to
spend their golden years.  When they heard what we were planning, they
rushed to climb aboard.  It's a done deal."

"How big an investment?"

"Twenty-five million."

"My God!  Did I hear what I think I heard?"

"Twenty-five big ones.  And we've already started clearing the land."

"Wait!  Wait!"  Betsy broke in.

"If we're to be in charge, and that seems to be the idea-' "We're
offering you the job," said Oilman, the fourth member of the team.

"We checked him out.  Chicago and Tampa.  You're the pair we want."

"If I'm a partner," Betsy said, "I want to have some say in which trees
can be cut down and which can't.  Because the people we'd want to
attract do not want to live removed from nature."

"You'll have maybe ten thousand trees to choose from," the lawyer said.
This land is forested.  Ask Desmond.  He owns most of it."

"In most of the areas, Betsy, you can't see the hills for the trees.

We've knocked down trees only where the buildings go, and the
parking."

"So," Mr.  Cawthora said, 'will you two take the job?"

"I'd want to see the land," Andy said, to which the men agreed.

"And go over the plans for the three buildings with great care. Getting
it right does make a difference."

"We're suggesting," Dr.  Zembright said, 'that we fly up there right

now.  A phone call, and we'll have cars waiting in Knoxville. That's
the nearest airport."

"Any good hospitals in Knoxville?"  Betsy asked, and Dr.  Zembright
assured her: "Some of the best.  Less than an hour's ride when you
reach the good roads."

"And how long does that take?"

"Maybe ten minutes," and she said: "Let's go."

When they were aloft and well on their way, Mr.  Cawthorn pointed out
the land below and said: "I want you to realize the vast change in
landscape and culture you'll be experiencing.  Down here in Florida the
wonderful bodies of water, perfect climate, the palms, the trees low
and sort of scrubby, the land flat as a table.  Up where we're heading,
real mountains, real forests, snow in winter, rough rural life.  Be
prepared," and his daughter replied: "If I've just completed preparing
myself for Montana, I'll bet I can do the same for good old
Tennessee."

They had now passed the Florida-Georgia border and were approaching
North Carolina, for the men wanted the Zorns to appreciate the Great
Smoky National Park, which soon lay below them.  Now Mr.

Desmond, the real estate man, made his comment: "This is gorgeous
mountain country, not as high as the Rockies in Colorado, but
infinitely older.  Everything you see down there will be your
backyard," and the Zorns had nothing to say, for this seemed exactly
the kind of setting a retirement center ought to have as its backyard,
but thoughtful Betsy was thinking: if, and it was a big if, there was a
community nearby and reliable access to hospitals in the larger
vicinity.  She would reserve judgment.

Her husband had anticipated her question, for he was asking Dr.

Zembright: "You mean you will build in the wilderness, almost, and
there would still be a chance to have some nearby village for the
residents to visit, and hospitals reasonably accessible?"

When they landed at Knoxville and hired two cars, they headed south for
their land, and soon they were passing through a comfortable looking
little town of about three thousand with clean streets and a big,
well-manicured central square with flower beds.

"Our residents," Mr.

Bingham pointed out, 'will be able to walk into this town anytime they
wish," and shortly thereafter the cars were picking their way along a
dirt road, soon to be paved, leading to the grove of big trees behind
which nestled the area in which the three buildings would be erected,
hospital to the east, main residence in the center, and condominiums in
the west.

In the first moments Andy thought: They know what they're doing.

With the aid of her father, Betsy had moved to a spot from which she
could see the lake: "It's even bigger than the map showed," and then
she gasped, for beyond it rose the three mountains, a small one to the
west, a big double to the east, with the Great Smokies just beyond.
Turning to kiss her father, she whispered: This really is a paradise,
nature at its most spectacular.  The challenge would be to keep it that
way."

At the end of the rather brief inspection of the land, with more than a
thousand acres of forest still unseen, Andy made a bold suggestion:

"Let's stay over tonight and fly up to Chicago in the morning.  That
is, if we can be sure John Taggart will be available."

"Why Taggart," Mr.  Cawthorn asked, 'if you've just left him?"  and
Andy explained: "Because he knows more about what makes or breaks a
retirement area than anyone else in America," and the deal was done.

In his office above Boul Mich, Taggart displayed his customary
bluntness: "Great idea.  Good location.  And your man Zorn has proved
himself, in one year, to be one of the best administrators of a
retirement center in the United States.  Now let's see your plans."

When the blueprints were unfolded, he cheered the mountain setting:

"Bold.  That lake will be worth a million dollars.  Can those little
mountains be seen from the buildings?"  But he was less enthusiastic
about other details: "I don't like your proposed name, the Hills.  It's
accurate, like the Palms, but we've found that we get an extra oomph if
we insert an adjective.  We tease the public into seeing the hills our
way.  An advertising advantage of no mean dimension.  How about the
Protective Hills?  No, too wishy-washy.  The Welcoming Hills?  Doesn't
sound right.  But you people give it some thought.  Come up with a good
adjective.  It'll help."

He was adamant that the large condominium buildings not carry the name
Sunset.

"Do not advertise this in any way as a last stop.  Just don't do it!
You'll scare people away," and with a bold pencil he scratched out
Sunset and wrote in Sunrise.  One of the men protested: "But the
building lies to the west, toward the sunset," and Taggart snapped
back: "You can't change that but you don't have to remind them of the
end of the day.  Always emphasize the beginning."

He commended them on having the hospital building detached from the
other two and on naming it correctly, the Health Building.  He also
liked the concept of protected walkways connecting the buildings:

"Keep the various services accessible to one another, but never
intrusive."

No point was too trivial to merit his attention, and it was he who
recommended that the three footpaths be differentiated: "The easy one
close, let's call it the Stroll.  The longer one around the entire
lake, the Walk.  And this tough one along the mountains, the Hike.
Believe me, people will enjoy the differentiation and take pride in
trying the long job."

He approved the preliminary thinking and applauded the idea of having
the nest of private homes off to the west: They'll be popular, you've
probably sold some of them already," and Mr.  Bingham nodded.

When he reached the fourth blueprint he saw something he apparently
didn't like and jabbed at it with his forefinger: "What are these
eleven little rooms on the first floor?"  and Zorn explained: "We'll
keep them available for worthy people who have only modest funds."

"Why?"  Taggart asked.

"Because I'd never want to run a posh retirement hotel for wealthy
people alone.  I want to have schoolteachers, shop owners and farmers
able to join us, too."

"That's a good way to go broke, Doctor.  Your first responsibility is
to see that your establishment is on a solid financial footing."

"I've learned that from you.  So I'll have a hard-nosed financial
wizard in charge of the money."

"Where are you going to find him?  If your entire operation rests on
his shoulders?"

Financier Desmond interrupted: "Our man is already in place.  My
younger brother Alfred.  Every time he has to spend a dime on my
projects he winces, demands a written estimate, then checks to be sure
the ten cents is properly handled.  With our funds backing the
enterprise and Alfred in charge of the money, we'll not go broke."

A big warm smile filled Taggart's face: "I like these eleven rooms.  I
like the idea of farmers and shopkeepers being able to join the
party.

Zorn, you're as good a man as I thought you were on that sleety day in
Chicago.  Go to it.

"Wait a minute," he said, snapping his fingers.

"I've got it."  He stood abruptly, leafed back to the second blueprint
and inserted the proper adjective, the Sheltering Hills.  Admiring his
handiwork, he said: "It's been gnawing at me throughout our discussion.
Sheltering sounds so inviting that I might want to apply."  Everyone
agreed it was an excellent name.

When he reached the fifth blueprint, the one showing in detail the
parking areas, he took one look, grabbed a bold black marker and
defaced the paper with a huge X: "Useless.  Miss Clements, bring in
that study of complaints from the field, seven copies," and when she
complied the visitors saw the heading: "Complaints from our Ninetyone
Directors."

Andy interrupted: "I thought it was eighty-seven," and Taggart said
without missing a beat: "But that was last year," and he continued with
his message, which stood out as if typed in big, boldface letters.  It
was clear and concise: "Insufficient parking 77, Monotonous food 43,
Inadequate health services 27."

Striking the report with his fist, Taggart growled: "They don't give a
damn about their own health, but they erupt in fury over a convenient
parking space for their car."  Jabbing at the areas indicated on the
blueprint, he said: "Triple them."

"You mean that much?"  Mr.  Bingham said.

"Look at the scale of that drawing.  Those are big spaces."

"Quadruple them, and this time two years from now you'll tell me:

"You were a genius, Taggart."  But do not open shop with only those few
parking spaces, or you begin with trouble, big trouble."

Here Zorn interrupted, "We might have big trouble on another point, and
I want to clear the air about it right now.  Am I going to appear on
your masthead as director or resident physician of Sheltering Hills?"
and Taggart said: "Before you decide, you men who are putting up the
money had better be informed about a problem you might face with a man
named Clarence Hasslebrook."

Mr.  Bingham interrupted: "Now, that's a curious name.  Fellow with
that name applied last week for one of our smaller accommodations."

"That SOB," Taggart growled.

"How could he have known about your project?"  and when the Chattanooga
men explained that an article had appeared prematurely in their local
paper, Taggart explained who Hasslebrook was and how he had the power
to make trouble for any retirement facility that did not kowtow to his
rigid interpretations of moral behavior.

"You mean, he threatened to label each of your facilities Murder
Mansion if you didn't fire Dr.  Zorn?"  Bingham asked, and after that
truth was ventilated, the group spent nearly an hour dissecting the
basic relationships between a retirement area, the local medical
services, the general public, and residents who had signed properly
witnessed living wills that permitted and even encouraged the cessation
of radical medical steps to keep them alive when they were technically
dead.

When Hasslebrook's stubborn behavior was fully described and
understood, one of the Chattanooga team asked: "Are we to suppose that
he's enrolling in our place to monitor us, and perhaps Dr.  Zorn in
particular?"  and Cawthorn reasoned: "How could he?  We didn't know we
were offering Zorn the job until yesterday."

Taggart said: "His crowd has spies everywhere.  They may have alerted
him to the fact that Andy's father-in-law was interested in a
retirement-home investment.  And remember, Hasslebrook is like a
weasel, sneaking around everywhere."  He paused, liked the analogy but
felt it could be improved: "More like a skunk, leaving a stench
wherever he moves.  You can smell him across seven states."

Mr.  Oilman, the financier, did not approve of that ad hominem attack:
"We may dislike the man and disapprove of his behavior, but life is
sacred and he has a right to defend helpless people who might not be
able to protect themselves.  Let's oppose him but not abuse him."

Now Dr.  Zembright, a medical man nearing honorable retirement, took
over: "The time's come when we must face up to these moral tyrants who
want to dictate how the rest of us shall live and die.

Especially when you're my age and have heard so many totally exhausted
or brain-damaged patients beg you to help them end their agonies, you
thank God for the public wisdom of the living will.  I've signed one
and I hope that the rest of you have, too, because I know what dying
means.  It can be a noble conclusion to a life well spent, or a
travesty of what the word life really means.  A birth, a period of work
and contribution, and a logical termination."

There was a brief silence after his impassioned remarks.  Then
Zembright sounded the battle cry: "Gentlemen, we have the funds to
withstand a siege from this enemy.  And we have the knowledge of what a
respectable retirement area should be.  We'll construct our facility in
the most humane way possible, safeguarding every resident's rights.

And then we'll welcome battle with this Hasslebrook.  Better yet, we'll
invite him to the fray."

And he proposed that the Chattanooga team prepare a news release
identifying Hasslebrook as someone who had already signed up for a
condominium in the Sheltering Hills, and what his agenda was.  He
proposed that the owners state forthrightly that they revered human
life and would take every step to prolong and make it tolerable.  They
were vigorously opposed to suicide, but because sensible people
nationwide seemed to want the safeguards of a living will, the
Sheltering Hills would honor such wills, providing they were legally
drawn and that the subject understood what each of the terms meant:
"We'll step forth as the real protectors of mankind and will welcome
the strictest supervision from the misguided Clarence Hasslebrooks of
the country who are determined to dictate the way other people live and
die."  Then, choosing his words carefully, he turned to Oilman to seek
a kind of peace with him: "The trouble, Charles, is that if we allow
the wrong people to preempt the right words and give them false
meanings, later we'll have to fight to win back the words and restore
them to their cleanliness."

When others wondered if taking Hasslebrook on in such a bold public
step was advisable, Zembright rejected their fears: "I'll sign the
release."  When this, too, was questioned, Zembright said: Tve built a
respectable reputation in eastern Tennessee, and there's no better use
to put it to."

"You mean you're willing to take him on?  Frontally?"  Taggart asked,
and the white-haired veteran said very quietly: Tve fought medical
battles all my life.  Some of you remember when I opened my offices in
Chattanooga right out of medical school and concluded, after a few
months on the job, that the public would be better served if I formed a
clinic of six or seven doctors like myself, each a specialist in his
own field.  One patient, one office, with all the consultations
required.  The established doctors vilified me, called me a Communist,
and even you, Desmond, damn you, refused to sell me that corner lot for
our offices,

and three years later you were one of our best customers and advised
all your friends to join our clinic.  You even gave an interview in the
paper: "Zembright's group is the wave of the future."  And when we
admitted blacks right into our waiting room, sitting beside you, there
was another fierce stink.  I've been through battles and I smell this
as just the next in line.  Yes, we'll take on Hasslebrook and his
attempt to dictate how we shall practice medicine," and he convinced
his partners that they must stand together and inform the citizens of
southeastern Tennessee that a war of principle was being waged in their
backyard, one that could reverberate throughout the nation.

Now Andy felt that it was obligatory for him to explain to the partners
what demands would have to be met before he accepted the position:
"Gentlemen, I think we'd all better take a deep breath.  You've been
free and easy making decisions about my position in your Sheltering
Hills.  A great name, Mr.  Taggart.  Thank you.  But you haven't asked
me under what conditions I might accept the job.  So here goes.  First,
I will not be your manager.  We'll hire a day-to-day administrator to
keep the residents happy.  Second, I will insist on being the medical
director, offering full on-site care for as long as each resident
lives.  I am determined to be a full-fledged doctor again, and nothing
less.  Third, I will want Nora Varney as my health assistant.  Fourth,
I will rely upon my wife, Betsy, a shrewd young woman, as my in-house
counselor.  And fifth, I shall revoke Mr.  Hasslebrook's rental of
quarters in our establishment.  I believe in the sacredness of life,
but I don't want him around poisoning the atmosphere.  Refund his
payment.  If you can accept those limitations, I think that Betsy and I
could make this the preeminent retirement area, all things considered,
on the East Coast."

Each of the four men who had invested substantial money in this project
had supposed that Andy would be the manager, and each brought forth
serious questions as to the practicality of what he now proposed.

"Can you become fully licensed in Tennessee?"

Dr.  Zembright answered: "I served on our licensing board for years.

It's safe to bet Andy's eligible to be our resident physician."

Another asked: "What are we going to do about this man Hasslebrook?"
and Andy said with considerable vigor: "Mr.  Taggart showed me how to
handle him.  Throw him out of our establishment right now.

Deny his application."

When two of the businessmen objected to such treatment: "He could
sue us.  We have to consider civil rights and laws ensuring that anyone
can live anywhere."  Andy said: "I think the time's ripe for you to
know exactly what this man has been threatening to do," and he
explained Hasslebrook's charges against him and his plan to hound Zorn
and destroy him.  The two men who had objected to throwing the agitator
out of Sheltering Hills changed their minds: "Any court would agree
that it would be suicidal to allow him to live right in the heart of
the institution he is determined to ruin.  We agree with you, Andy,
throw the bum out and dare him to sue."

The financiers were not as pleased with Andy's desire to have Betsy as
his general assistant: "Sounds as if we'd have another Hillary Clinton
on our hands."

"We both voted for her husband," Betsy confessed, and the partners
groaned.

"Did you think when you cast your ballot," Mr.  Oilman, the financier,
asked, 'that you were also voting for Hillary to serve as
co-president?"

"Let's put it this way," she said blithely.

"You might as well accept the conditions Andy has laid down.  I'm well
aware that my father will probably leave me his shares of the
partnership, and voila, I'm automatically an equal shareholder."

Mr.  Desmond said: "Not if I can buy his shares from him," and the
group appreciated that the recent exchanges had not been idle banter.

The corporate jet flew back to Chattanooga, where Betsy bade farewell
to her father, thanking him for the gallant moves he had made in
gathering this group of financial supporters: "They'll be proud of what
Andy and I accomplish.  We'll set new standards for the industry."

She also bade a warm farewell to Dr.  Zembright: "Andy taught me to
walk again, but your surgery made it possible for me to survive," and
she kissed the old warrior.

One night after twelve, as she had promised she would, Helen Quade
walked along the silent corridors of Gateways until she came to the
apartment of Ambassador St.  Pres.  There she stopped, knelt and
slipped under the door a slim parcel containing the typed manuscript of
three chapters of her forthcoming book on male-female relationships,
Likewise the Mistress, Too.  Having done this, she retraced her path,
trusting that she would encounter no one at this late hour who might
misconstrue her purpose.

In the morning when St.  Pres reached down for his paper, he found the
package, was more than casually interested in how Reverend Quade might
have explained her conclusions about men and women, and ate his
breakfast of fruit juice and a tasty mix of orange slices, bananas and
raisins.  As he did so, he scanned Helen's essays and saw that the
first two covered much of what she had said when they had argued in the
tertulia, and he noted the skill and grace with which she wrote.  But
the third chapter broke new ground, at least for him, and he had barely
reached the second page when a diagram captivated him.  It showed two
extremely elongated triangles parallel to the foot of the page.  The
base of the top one was two inches wide at the extreme left of the page
and withered away to a dot at the extreme right.  The bottom one was a
mirror image, two inches at the right, a dot at the left.  The first
was labeled FEMININE TRAITS, the bottom MALE TRAITS, and each showed
graduated numbers, 100 at the base, 0 at the apex.

It was what the minister said to accompany the diagrams that caught St.
Pres's attention:

We can conclude from the accumulation of scientific evidence cited
above that most human beings are neither all male nor all female.  In
fact, I think there is good reason to accept the theory that humans who
function with the greatest efficiency in all fields have a proper mix
of both male and female characteristics, and that those unfortunates
who are one hundred percent either male or female are destined for
psychological or social dysfunction.

The man who is 100 percent masculine, with no ameliorating grace of a
few feminine traits, is doomed to be what Edgar Spencer characterized
as 'a complete macho and a total bore," while the poor female who is
100 percent female with no stiffening attributes of the male is apt to
become a nymphomaniac, unable to control her sexual urges.  People of
judgment find either of the two extremes distasteful.

On the other hand, the unfortunate person who stands at the midpoint,
the 50 percent marker, of both the male and the female measure is
almost doomed to a life of confusion and even tragedy.  The optimum mix
would seem to be 80 percent of the dominant characteristic, 20 percent
of the opposite.  In women this proportion can produce a creature of
great beauty but also of strong will, and in the male it seems to
produce men of powerful character able to make decisions but softened
by a love of the arts, an appreciation of beauty and a concern for
social justice.

Any educational system geared to produce 100 percent females or 100
percent males is not serving its nation well, and either men or women
who drive themselves to function at or excel at the 100 percent level
of their sex cheat themselves and do a disservice to society.

He was so taken by this reasoning and so impressed by the diagram that
made her argument visible-she had the 100 percent area in each pyramid
a heavy black, with a progressively lighter screen, until the area
approaching the pointed apex showed an almost clear white.

"Damned effective, that visual," he said as he galloped through the
remainder of the chapter, discovering at each point some insight that
pleased him.  When he reached the last page he telephoned the Reverend:
"Helen?  Richard here.  Would you be free to take a short stroll with
me?  I've finished your Chapter Three and find a wealth of points I'd
like to discuss.  Rough gear if you will.  We might be heading into the
savanna."

It was about ten when they left Gateways, each with a stout walking
stick and she with a pair of binoculars.  He remembered to bring scraps
for the birds, and when the screaming gulls had broadcast the news that
here came food, they walked past Judge Noble's old spot with egrets and
herons and pelicans in attendance, but soon they were in rougher parts
of the savanna.

When they reached the Emerald Pool, St.  Pres suggested that they rest
on a hummock overlooking the green water and from this vantage point,
which gave them a view of the savanna south and east, the channel to
the west and the towers of the Palms to the north, he opened the
subject that he wished to discuss: "Your diagram of the range of
characteristics that a woman can have, and the same for a man, hit me
very hard because I discovered that truth, for myself, when I was
eighteen or nineteen.  My parents could afford to have me attend an
expensive private school that had a super jock as coach, Bully Sykes, a
lineman when Fordham had their famous Blocks of Granite.  Boy, was he
tough!"

"And he gave you a bad time?"

"Not at all.  I was about as tall as I am now, slimmer, but good at
playing end and receiving passes.  I was-you might call it-Bull's
pet.

The way he treated me proved he could also handle the straight-A
student.  He didn't like me, I wasn't his type, but he accepted me,
especially since I won several games for him with my diving catches.  I
could really stretch out."

"So what happened?"  she asked as she kicked pebbles with her hiking
boot into a rather large hole in the bank by the pool.

"You have a big bust-up with him?"

"Oh no!  But when he gave his totally asinine pep talks I used to
think: This is pretty stupid, and a couple of times he caught me
looking at the ceiling when he came to his bit about the glory of the
school and the forthcoming test of our manhood.  I was thinking:
There's also the approach of Mr.  Strang.  He doesn't have to employ
such nonsense.

Strang taught English.

"I remember thinking in the middle of the Lawrenceville game, our
win-all-lose-all battle, that I did not want to be like Coach Sykes or
Master Strang, the first was too masculine, the second wasn't masculine
enough.  And I do believe that in the middle of that crucial game I
realized that I was no more than eighty percent of what Coach Sykes
advocated.  And what was the other twenty percent?  I was not able then
to define that other component of myself, but I knew it had something
to do with Thomas Hardy, Wordsworth and that marvelous befuddled

Russian clerk in Gogol's The Greatcoat.  Now I can see that it was the
aesthetic element, and in later years that strain developed rather
strongly."

He looked at her handsome face marked with a few wrinkles.

"Was your experience somewhat similar?  How old were you when you
deduced what you wrote in the chapter?"

"I think I knew from childhood.  With a boy you don't get the macho
indoctrination till you encounter someone like Bully Sykes in your late
teens.  With us girls, our hundred percent femininity is drilled into
us from birth.

"Pink is for girls.  It's important that girls take care of their hair.
Girls should never sit with the knees far apart."  I was hammered at,
but one elderly woman in China gave me a good tip: "When the camera
looks at you, never stand with your feet side by side.  Always place
one foot well ahead of the other and close in."  So when I see the
photographs from the missions, there I am looking like a million
dollars, and the other poor girls, my classmates, with feet planted
together looking like country clods just off the farm."

St.  Pres, not reluctant to let Helen know how much he admired her for
her sharp wit, asked: "How did you learn so much, Helen?"  and she
replied: "Constant reading-and picking the brains of brilliant men like
you."

"In college, too?"

"When you're the child of an American missionary family your daily life
is a university education.  People are constantly amazed at how
accomplished the children of missionaries are.  Henry Luce, Pearl Buck,
John Hersey, a half dozen college presidents.  A major part of the
explanation is that the missionary father has a wife who is also a
missionary, just as well educated as he is.  The children cannot escape
being intelligent, and because the family is so poor, the children have
to be clever about money.  What a combination, guaranteed to produce
greatness."

"Your diagram representing the life experience of human beings and
their mix of gender characteristics-that was brilliant.  It put me
right on the nose-eighty-twenty and content to be that way.  How do you
place yourself on the scale?"

She enjoyed discussions like this, so although she realized he had
asked a somewhat improper question, she responded: "I'm closer to
seventy-five-twenty-five.  I have a very strong masculine-type under
pinning.  I think it was the only thing that allowed me to stick it out
in the battles I had to fight."

"But the public sees you as so feminine-so exactly right."

When she heard this praise, delivered for no logical reason that she
could discern, she suddenly thought: Good heavens!  I wonder if he's
mustering his courage to propose, and she became as fluttery as she had
been in the early days at the China mission station when she'd done
everything within the bounds of decency to win the love of that young
man new to China.  For most of this year she had placed herself where
the ambassador could see her, had praised his views when they
participated in discussions, and had made much of his brilliance when
she was invited to the tertulia.  Jimenez is a polished gentleman, she
had told herself.  Senator Raborn has a mastery of political and social
knowledge, and President Armitage is a world-class brain.  But Richard
is all those things.  And now she surmised he was preparing to ask her
to marry him, he seventy-nine, she seventy-five.

During the long pauses that followed, with him praising her attributes,
she was able to think clearly: Yes, if we lived in some small town, I
in my little cottage and he in the big house near the golf links.

And I was retired from the church on a meager pension.  And I lacked
companionship.  Yes, it would make sense.  But here in the Palms, where
I have nearly two hundred friends, and good conversation, and a secure
life, and a job as de facto chaplain to the place, and access to so
many exciting adventures, I don't need a husband.

And she realized, at the conclusion of her silent monologue, that the
Palms provided a life so acceptable and of such a superior quality that
it made it reasonable for her to think of herself as already married to
the ambassador.

She knew that in decency she ought to intercept his proposal before it
was made, to protect his ego if for no other reason, but as a woman who
had had to fight men in her battle to obtain recognition in her Church,
and for understandable considerations of personal vanity despite her
age, she did want to hear his words.  So, while doing nothing to
encourage his declaration of affection, she also did nothing to halt
it.

"Helen, I've been so touched by your humanity, your genuine acceptance
of people of all types-I've been proud to think of you as my newfound
friend."

Those are words of high praise, Richard."

"And your performance as the unofficial chaplain of the Palms, it's
been exceptional.  You're a spiritual consolation to all of us, an
invaluable asset."

"I'm a New Testament Christian.  It's as simple as that."

"But you do it so wonderfully-you're an exemplar."  A long pause:

"And I've been wondering if perhaps... since we work together so well
in the tertulia discussions ... I wonder if there's a possibility that
we could work together in a more settled structure."  Longer pause.

"Could we find increased happiness .. . and stability ... if you would
consent to marry me?"

"Richard!  What a gallant suggestion!  It's quite overwhelming-at our
ages.  It's the loveliest idea ever, and I'm profoundly honored."

"There need be no changes in our patterns of life, no radical
alterations in our financial arrangements.  It could be said to be a
marriage of two like minds, clean and mutually productive."

Reverend Quade was taken aback.  This had developed far more quickly
than she had anticipated.  His reasoning was far more advanced than she
could have expected, and she was not sure how she could reject such a
sensible proposal, but since she had firmly decided not to marry before
the conversation veered in that direction, she now knew that she must
make her position clear.  To do otherwise would be unfair.

"Richard, we haven't many years, you and I. We've organized our lives
in rewarding patterns and I don't think we should disrupt them by an
action which might have been eminently sensible sixty-even twenty-years
ago but which would lack any real justification now.

Mentally, in our attitudes toward society, in our behavior toward our
associates, we're already married.  I think we should let it go at
that."

"But you sidestep the fact that I've grown to love you, that I need
your companionship.  The fact that I'm nearly eighty makes my desire to
get my life properly organized even more pressing.  I would dearly love
to spend with you what years remain."

"And so you shall.  Right here where we are.  We can dine together any
evening you wish.  We can take walks like this any day.  We can pass
into our eighties as dear, close friends.  I see no pressing need for
change."

Not trying to hide his dejection, he asked almost pleadingly: "Are you
saying No?"  and she clasped his hands, smiled warmly and said: "I

am, and I know I'll regret it many times.  But no, I think that for us
to marry would be wrong and unnecessary."

He sighed, rose, moved away from the Emerald Pool and said:

"You'd have been the ideal wife for an ambassador in a beleaguered
African nation.  So much to do, so many lives to shape."

"I'm still striving to achieve those same worthy ends, and so are you,
but in these autumnal days we spend our efforts with those who are
leaving life, not entering it," and she caught his hand, used it to
pull herself to her feet, and embraced him.

On their slow walk back to Gateways St.  Pres said: "There are times
when it's not entirely advantageous to stand eighty-twenty in your
diagram.  If I were ninety-five-five I'd not have talked so much.  I'd
have stated my position, knocked you on the head with my club, and
dragged you back to my cave."

When she laughed at this alternative he said seriously: "And if you'd
been ninety-ten, you'd have accepted me on the sensible grounds that
every woman should have a husband-as proof of her ability to capture
one."

She reflected on this, then said: "You may be right, Richard.  I was
certainly so motivated when I chased my young missionary, and landed
him.  But today .. ."  She was going to say she had grown more mature,
but instead she said: "No matter how old we get, we never quite
understand the basic drives that help determine our behavior."

When he delivered her to her quarters and saw everything not only in
place but conveniently located, he said ruefully: "No need for you to
change, Helen.  Modern society has rendered the husband superfluous,"
and as she ushered him to the door she said: "But not the fellowship of
a man I adore."

The standard escape clause: "Let's be friends."  The threnody of modern
courtship," he said, and she kissed him good-bye.

Three days after Christmas, as had been planned in April, the Raul
Jimenez tertulia, lacking its leader, laid their hands on the polished
plane and pushed it into position for takeoff, with almost the entire
population of Gateways standing by with their cameras while two
television crews waited with theirs.  As he had done on his earlier
midnight flight, pilot St.  Pres carried out the traditional check of
his craft and baffled some observers by dropping to his knees and
opening the petcock to test the gasoline.  A minute amount of
condensation had occurred; he let it drain, smelled his fingers to be
sure the remainder was gasoline, and all was ready.  President Armitage
and Senator Raborn helped him into the pilot's seat, Max Lewandowski
made a final check of the propeller, and then everyone stepped back.
The starter soon had the engine coughing, then catching and finally
almost roaring in the ears of those close at hand.

Since the cockpit had no doors-they were optional and could be added
later-St.  Pres, proudly sitting up straight, was free to wave to the
cheering crowd before turning to attend to his job.  Obtaining takeoff
clearance, he released the brakes, eased back on the wheel and started
his plane down the runway.  Pulling back the controls, he soared into
the air as nearly two hundred residents and townspeople applauded. This
time he did not fly out over the gulf but kept the plane in a confined
area so that its progress could be followed both by those on the ground
and by those watching excitedly from their Assisted Living windows at
the Palms.

Then, as the plane circled in the sky, it alternated altitudes,
sometimes flying close to the heads of the watchers, at other times
climbing with a steepness that startled those who knew anything about
flying, then leveling off through the cloudless winter sky.

As the plane demonstrated its capabilities-and they were awesome
considering how it had been built-a collective consciousness of a
mind-boggling phenomenon gripped the crowd.  The average age of the
five builders was 79.2 years, the probable average of the spectators
from the Palms was seventy-four, but as the spectators saw the plane
that they, in a sense, had built and realized that the pilot was one
year short of eighty, a surge of enormous pride engulfed them.  They
had done it!  These elderly men whom many outside the Palms would have
deemed too old to accomplish much of anything, had built an airplane
just as they said they would, and had flown it to celebrate the
beginning of the new year.

This remarkable achievement buoyed up all the watchers.  Look!

He's buzzing the field to salute us!  And a roar went up-a carefully
modulated roar, since the voices were so old and many of them
cracked-and the crowd edged forward to see how the ambassador would end
this historic flight, but he confused them by flying far to the south,
turning in a big circle, taking another complete circle and then
activating an ingenious device that Maxim Lewandowski had contrived.
When St.  Pres released a catch, a long bundle trailed from the rear of
the plane and, unfolded in the wind to reveal a large white banner.  As
the plane dragged it overhead the spectators could read RAUL Y FE
LICITA  This display brought no roar of approval, only the silent
salute of the Jimenezes' friends to mark their passing.

His job done, St.  Pres flew his aircraft to the far end of the field
and checked the windsock, then landed it perfectly and taxied it back
to the starting point while cheering people crowded forward to
congratulate him.  That evening when the tertulia, with Lewandowski as
an honored guest, convened, the dominant question was: "What do we do
with the plane now?"  and President Armitage had a ready answer: "Let's
give it to one of the industrial high schools.  The sooner their
mechanics learn about planes the better."  The men investigated various
schools till they found a junior college with a shop foreman who
already had his small-plane license.  In the months to come, the Palms
residents would occasionally see the plane in the skies above the palm
trees, and some would think of Ambassador St.  Pres and others of Raiil
Jimenez.

On his last day at the Palms, Andy rose early, walked through all the
corridors of all the buildings bidding farewell to the workers who had
supported him so energetically and who had seen the rooms filled to 96
percent occupancy.  Together they had converted a marginal operation
into a minor gold mine, and they were proud.  He could see that
although they restrained themselves they were sorry to see him go and
angered by the reasons that had driven him away.

"Good luck in Tennessee!"  some of the workers cried as he passed, and
one or two gave him more sturdy encouragement: "Don't let the bastards
grind you down," and at these words he reflected that this was the task
of honorable men wherever they worked.  There were adverse forces, some
natural like hurricanes, some like Clarence Hasslebrook, whose job it
was to oppose men and women of goodwill.  No one escaped their
pressure, but strong men and women found the courage to oppose them, no
matter what the cost.

"If you run the new place the way you've run this," one woman said,
'it'll be a shoo-in."

"I want it to be," Andy said as he left the building and walked outside
into the crisp January air, and as he did, both his lungs and his
spirit expanded, for now he was back in touch with nature.  True, the
savanna was badly scarred, but the new plantings along the proposed
roads seemed to be doing nicely, and the four small lakes did have
water in them, which moved from one to another by means of little
streams that a child could jump over.  The individual residential
buildings that would complete the Palms and ensure its financial
security were nearing completion, and they did not look entirely
deplorable: "With people in them and green grass sprouting, I suppose
it'll be almost acceptable."  Then he laughed at himself: "My successor
will never have seen the savanna or known what a splendid part of
nature it had been.  He'll never miss it, but I'm glad that the
Sheltering Hills will have trees and lakes and mountainsides that will
last at least for our lifetimes.  Thank you, God, for that national
park and our thirteen hundred acres.  If we mess that up we should be
ashamed of ourselves."

His throat choked as he came to the ruins of Judge Noble's empty chair,
rooted in concrete, and he sat on it awhile, visualizing the judge and
his birds.  Of course the gulls came, screaming abuse at him for not
bringing food, and the white egrets and blue herons strutted by to
check whether he intended fishing, then moved on in disgust.  Pelicans
dived in the channel, and to his delight, a late-arriving manatee moved
lazily up the warm current to his regular haven.

"I had a good year here, thanks to the birds and manatees.  My
regards," and he thought with regret: Farewell, old friends.  None like
you in Tennessee, and he wondered what he would find there.  With those
woods and mountains he was sure there would be wildlife he would find
just as wonderful as the pelicans and manatees.

A short turn to the left brought him to the neglected Emerald Pool,
which had so captivated him in his first days at the Palms, and here he
stopped to rest on a grassy hummock overlooking the limpid water and
prepared himself for the two difficult interviews he must conduct

470 --before making his departure.  Feeling little hope that he could
bring these matters to a successful conclusion, he rose, squared his
shoulders and marched back to his office.

The first interview was with Helen Quade, and when this stately woman
with a touch of grace in all she did joined him, he said pleadingly:
"Helen, I hope you've reconsidered your refusal to join our team in
Tennessee."

She smiled as if she were a teacher and he a pupil, then said with
quiet firmness: "No, Andy.  I can't go with you."

"Why not?"  he begged, and she said: "In these last few days since you
proposed such a move, and with a salary attached, I've had to study
what I believe in as a human being, not as a clergywoman, and I realize
that I'm like all the others living here.  I came here to organize a
spiritually satisfying end to a life that has been mainly beautiful and
which I shall fight like Berta Umlauf to keep that way.  I trust I will
have better luck than she did.  But I'm like precious Raul Jimenez,
gunned down by his perpetual enemies.  Or like dear Muley Duggan,
caring for his wife to the end.  And I'm like all the wise widows who
come here quietly to assuage their grief over the loss of their
husbands.

Andy, I'm one of this decent, self-respecting congregation, a vital
part of it, and I doubt that I could find anything as meaningful in
Tennessee."

She stopped, looked at him with tears in her eyes and said: "I'm in my
mid-seventies, Andy, and I don't have the energy to build a new
congregation."  She waved her hands as if erasing the unworthy thought
of giving up.

"Of course I have the energy.  I'll have the energy till the day I die,
but I've invested years of my life in building a haven here, and here I
will remain among my friends as each day we grow older and each month
some of us falter, and each year some of us die.  That was the great
adventure I entered into years ago and with which I am now content."

She rose, said something about wishing him and Betsy well in their new
home, then asked: "Andy, would you allow me to say a prayer for both of
us?"

"Please."

"Dear God, Andy and I have been partners in striving to bring decency
and order into this special place.  We've had triumphs and disasters,
moments of great joy and tragedy, but we have prospered.

Please give us additional strength to continue to do Thy work in

helping the lives of our friends wind down to a conclusion that Thou
would approve of, he in his new obligation in Tennessee, I still in
Florida."  As her final words passed like a whisper in the room, she
took Andy's hands, drew him to her and gave him the kiss of Christian
charity.  Then she slapped him soundly on the shoulder and cried: "Off
with you.  Your job here's been completed, handsomely," and she started
to leave, but at the door she turned and broke into a roguish chuckle:
"They tell me Clarence Hasslebrook has rented rooms in the village next
to your new retirement center."  When Andy winced she added: "He is a
fool, but remember, he's also basically right.  Life is sacred, and
sometimes we need men like him to protect us old people."

"But do they need to come in the likes of Hasslebrook?"

"God sometimes uses strange messengers to do His work.  Tread softly,"
and she raised her right hand to bestow blessings on Andy and his new
ventures.

His next appointment was with Bedford Yancey, his genius rehabilitator,
and when the lanky Georgian entered, Zorn went right to the point:
"Yancey, we need you in Tennessee.  And you'll have so many advantages
there.  New buildings, a fine gymnasium, state-of the-art exercise
machines, and more money than you can make here.

What do you say?"

"Like I said before, I can't do it, Dr.  Zorn."

"I still don't understand why," Andy said, and he was shocked by the
simplicity of the answer: "Tennessee may be all you say, but it has one
real fault."

"What's that?  Maybe we can correct it."

"None of the big-league baseball teams train there.  Within striking
distance of Tampa there's a lot.  And I've got to stay here to keep in
touch with them."  He paused, and before Andy could probe deeper,
Yancey said: "I love baseball.  I love bein' around the professionals.
I'm stayin' right where I am, and Ella feels the same way."

Having failed twice to persuade some valued members of his staff to
move north with him, he could comfort himself with the knowledge that
his most valuable staff member would be making the trip, for on the day
he and Betsy decided to go to Tennessee they had approached Nora and
said: "We'll need you in the new place.  You especially, because up
there I'm going to be a full-fledged doctor, not the manager of a posh
hotel.  We'll get someone else to do that.  You're to be my head nurse,
and together we'll give Tennessee the best retirement facility in the
States.  Just what our brochures promise: "Full medical attention
guaranteed for the rest of your life."  ' "Sounds exciting," she had
said, 'but I hate to leave Dr.  Leitonen and my AIDS patients."

"We understand.  But there'll be work to do up there, too, and we know
you'll find it," so she had agreed to make the move.

Now, on their last day together at the Palms, Andy promised her:

"We'll provide the very best, and you and I will have a great time
working together on our patients' care."

As he made his way down the hall he was now stopped by a committee of
residents who had come to express their thanks for his impeccable
management.  They were four citizens of Gateways whom he had especially
liked and who were indebted to him: the Mallorys, whose lawsuit he had
helped resolve in their favor; Ms.  Oliphant, whom he had helped
through her battle with cancer; and the Duchess, whose temperamental
excesses he had tolerated with good humor.

"We wish we could go with you," Ms.  Oliphant said, and the two other
women began to sniffle.  Mr.  Mallory joked: "Aren't you glad you
allowed us back in after we behaved so poorly three times?"  And the
Duchess asked coyly: "We defended the honor of the place, didn't we?"

He embraced them all, sniffled himself, and said: This is a marvelous
way to say good-bye.  Live to a hundred, all of you," and he was off.

By the time he joined Betsy and Nora in the car, his spirits had
revived and he was ready for the final farewell.

As he started his car and drove around the oval, Ken Krenek came
rushing from the building and ran across to intercept him as he was
about to pass through the gate.

"Hey!  Andy!  I came to say good-bye and wish you well.  You were one
of the best."

"I thought we said a proper farewell at the dinner last night, but
always glad to have another.  Ken, you proved yourself a most excellent
assistant, and as I said: "You're ready for the big job."  Tell Taggart
I said so."

Krenek did not want to hear this: "Andy, you must have seen.  I was cut
out to be a damned good second in command.  Help the big boss achieve
his goals.  I'm good at that.  Anything higher, I get nervous."

"You mean you'd turn down my job?"

"Yes.  I like things to stay the way they are," and he leaned in the
car to bid good-bye to the two women, and when he turned back to the
home base on which he felt secure, Betsy said: "He's such a good guy,
I'll miss him."

Finally they drove down that superb avenue of soaring palms on the
left, a fugitive Brazilian pepper tree hiding among the oleanders on
the right, and when Betsy saw the bright red berries she was loath to
leave them.

"Stop the car, Andy," she said, and with her cane to aid her she walked
over the rough ground to the pepper tree and broke off a large branch
covered with an infinity of berries.  Back in the car she said: "I'll
bet they'll last till Tennessee, and provide us with a housewarming
there.  Let's go."

But Andy did not start the car immediately, for he too was moved by the
thought that this might be the last time he would ever see those
majestic palms, with their halo of green only at the top.  And as they
left the Palms they looked back with affection at the towering palm
trees.

As the three expatriates reached the North Carolina border with the
Great Smoky National Park lying just to the west, Betsy smiled
mysteriously and chuckled, and when the others asked: "What's so
funny?"  she said: "The floating white angel, and the way she diverted
attention from who did the break-in."

"What do you know about the angel?"  Andy asked, and Betsy said: "I
invented her.  She was my idea, a brilliant one, if I do say so myself.
A real angel!  Two different witnesses saw her, didn't they, and
others, too?"

"Come clean," Andy said as he headed up into the Smokies, and Betsy
explained: "I found myself identifying tremendously with poor Berta
Umlauf, I'd been so close to death myself and had contemplated it much
more deeply than either of you two could know.

"So death is very real to me and when I watched that marvelous Umlauf
family frustrated in every move they made to help their wonderful old
mother die in peace, the way she wanted, I think it accurate to say
that my blood boiled.  I mean it.  My temperature rose to the boiling
point, and when I heard how Gretchen Umlauf had vomited after seeing
her mother-in-law lashed to her bed with gizmos sticking into her body
from all angles, I decided to help and arranged for Gretchen's son to
slip her into Extended Care by a back door that few used.  In a flash
of inspiration I told her: "Let's make it as mysterious as possible,"
and gave her a flimsy white nightgown, all lace and frills, that a dear
friend had given me when it was thought I'd be bedridden for the rest
of my life.  When I helped Gretchen into it, I kissed her and said:
"You're doing God's work, kiddo," and off she went into local
immortality.  An angel who really did God's work.  Helped a noble
woman, old and worn-out, enter heaven as God intended."

Suddenly she clapped her hands: "To hell with Clarence Hasslebrook and
his plots against us.  We'll fight him all the way!  Sometimes the good
guys really do win."  As the three people who would be responsible for
the character of the Sheltering Hills approached the dividing line
between the states, Betsy surprised the others by asking Andy to stop
so that she could get out.  As she stood there with her cane she said
in a whisper: "Last spring I left Tennessee a hopeless cripple ready to
die.

Now this year I walk on my own legs back into my beloved state ready
for whatever needs to be done," and in this determined spirit the three
associates crossed over into Tennessee.

Almost as soon as he wakened on the day after Zorn's departure, Richard
St.  Pres realized that things were beginning to unravel.  He found, on
attempting to read the morning paper, that the cataract in his left eye
had worsened, for he could not maintain his focus on the print.  He did
not panic, since he had been warned that slow, manageable deterioration
would probably occur, but it was an irritation, for it presaged the
inevitable diminution of eyesight toward that day when he would have to
undergo eye surgery.

To bolster his spirits, he gave himself a pep talk: "Not to worry. They
tell me you go into the opththalmologist's office at nine, have the
operation-forty minutes-leave at eleven and drive home, if you wish. 
Nothing like the old days when you lay immobilized with bags of sand
locking your head in a safe position."  But when his infirmity seemed
to worsen as he read, he concluded: "I'd better check it out with Dr. 
Farquhar," and he thought no more about it.

When it came time to dress for a morning meeting at which he was to
represent the residents in a confrontation with the Palms' manage rial
staff about an increase in monthly fees, he started to tie his necktie_
something he had done thousands of times.  Over fifty years earlier a
Harvard classmate noted for his meticulous grooming had seen that St. 
Pres was accustomed to fix his tie in an ordinary four-in-hand knot,
which produced an uneven knot that kept sliding off to the left.

"Richard, my dear friend," the man had chided: "Has no one taught you
the latest in neckwear?"  and the dapper young man had demonstrated the
Windsor, an intricate maneuver in which the right hand wove the long
end of the tie under and over and about the shorter end, with a most
satisfying result: "There, you see.  The knot is handsomely centered
directly over your Adam's apple, but it is also wide at the top and
neatly tapered toward the bottom.  Voila!  You are now a gentleman."

From that day on, St.  Pres had meticulously followed the intricate
procedure, gratified when his silk ties, on which he had spent much
money and more care, had been paraded before the world and the
television cameras.  But on this morning, as he entered upon the
routine of making the knot, he mysteriously forgot how to manipulate
his right hand.  The long end of the tie did not behave and the
proposed knot became a mess.  In a mild confusion and with a growl of
irritation, he ripped open the knot, straightened the ends of the tie
and began again, but now he was trapped in a phenomenon that attacks
many otherwise competent men and women: when he tried to think his way
through what had become a daily routine requiring no thought whatever,
he found himself totally unable to sort out what he was doing.  His
brain could not keep up with his fingers; indeed, his fingers required
no input from the brain and when mental suggestions arrived, they
confused the fingers rather than instructed them.

For a second time he failed to complete this simple operation and the
knot became an impossible jumble.

Clawing at it, he dissolved the knot, straightened the ends and
proceeded to instruct himself as if he were again a little child: The
right hand with the long end is the important one.  Over and under,
then around and under, drawing it tight to make that handsome square
knot.  Then over, under and around.  End with thrusting the long end
into the knot and tighten everything."  Surveying with childish pride
the finished knot, finally perfect in all respects, he congratulated
himself:

"See!  It wasn't such a big problem after all."

But then he stared at himself in the mirror and broke into a nervous
laugh, for he remembered how, as a Boy Scout at summer camp in Vermont,
he had been reprimanded by the scoutmaster: "Richard, you'll never be a
proper Scout until you learn to tie something besides a granny knot.
See how it pulls apart the way you tie it?  It's easy to tie a square
knot, and look!  No power can break that knot apart."

"How do I do it?"  Richard had asked him, and his instructor had made
the task an easy one: "The right hand controls.  The left hand never
moves.  Right hand under, then bring it back over, draw it tight and
you have a perfect knot."  The half-smile in the mirror vanished, and
in its place came a look of trembling fear: Am I beginning to fall
apart?  A simple thing like fixing a necktie, and I almost crumbled.

Studying his features in the glass he conducted an inventory: Hair
thinning and turning white.  Teeth showing signs of cracking.  Nose not
taking in and delivering the amount of oxygen it used to, so lungs less
efficient than before.  Ticker seems OK but the legs are weakening, and
that damned cataract does creep on apace.  Still, in reaching a summary
he said: "Not hopeless, all things considered.  I can still stand erect
and I look as good as any of the others ten years younger than me."

Then came the doubts: "Did the tie fiasco have any real significance? I
mean, was it a premonition, a signal that disintegration really is
speeding up?"  The question was so unsettling that he remained for some
moments staring into the mirror, and the more intently he studied
himself, the more frightened he became, so much so that he telephoned
President Armitage and asked to be excused from the morning meeting:

"I'm a bit queasy, not in top form.  I need fresh air."

As he prepared to leave his quarters he chanced to see himself once
more in the mirror, and with a brusque wave of his hand he obliterated
the image: I'm as good as I have a right to expect, and with that he
ripped off the offending tie, cast aside his dress shirt, kicked off
his black trousers and dress shoes and dressed instead in what he
called his "African gear," stout bush shoes, heavy twill khaki pants,
rough shirt, English-style scarf and wide-brimmed felt hat.  In this
garb he stepped briskly from his room, strode to the elevator and
descended to the ground level, pleased that he did not encounter anyone
to whom he must explain what he was doing.

As he left Gateways and started for what used to be his beloved savanna
the noisy gulls began to gather in the air.  Soon, realizing that

St.  Pres was bringing them no food, the angry gulls began to chastise
him, screaming through the air and diving almost on his safari hat.

Two of the swift gulls came very low from two different directions,
streamlined forms so like those of the Japanese suicide planes that had
tried to sink his cruiser at Okinawa.  The kamikazes, cheaply built
airplanes carrying unbelievably large cargoes of explosive, were
piloted by fearless young men whose job it was to seek out the American
warships and dive directly into them, destroying their plane, them
selves and the enemy ship.  So many had attacked his ship that hectic
morning that now the sky became filled not with seagulls but with
screaming Japanese warplanes, and he was again in uniform, fighting the
enemy.  y One bird, infuriated by St.  Pres's empty hands, wheeled in
the sky and flew directly back at him, head-on, and his motions were so
like those of a kamikaze that Richard cried: "It's him!  The one who
nearly sank us!"  and he clenched his fists as if once again activating
the antiaircraft guns on his cruiser.  The suicide pilot seemed
immortal, for he continued his dive through an aerial carpet of flak,
on and on, coming ever closer to Richard's ship.  But at the crucial
moment, bullets from the cruiser struck the plane and aborted the dive,
so that in a flash the kamikaze whirled by overhead, missing the ship
and exploding in the sea beyond.

In the fatal second as the airplane missed its mark, St.  Pres caught a
glimpse of the Japanese pilot, a boy of about seventeen, as he fell
into the sea, having accomplished nothing.  Waving his right hand at
the fiery gull, St.  Pres ended in a reverent salute to the young pilot
who had come so close to destroying the cruiser.

He was now at the edge of that portion of the former savanna that
resembled those portions of Africa that had most deeply affected him,
the great veldts south of the Congo.  Staring at the scarred land from
which all growing things had been erased, he visualized once more that
reach of spiny shrub, berried bushes and scrub trees in which he had so
often trekked, and as he saw these forms rising like gray-green ghosts
from the barren land he recalled those hectic, harried days in which he
had won his civilian medals, from President Truman this time, as a
rather young chief of mission at an American consular post in one of
the minor African states that had been carved out of the former Belgian
possessions neighboring the Congo River.

So on this morning of reflection and evaluation, Richard was traversing
meaningful ground.  Somewhat to the south of where he had entered the
barren ground now completely restructured by bulldozers, he could see
areas that had not been totally denuded and he made his way toward
them, thinking as he went.  This really could be Africa.  Those low
shrubs ahead.  The Brazilian pepper trees.  That vagrant tree here and
there, short but growing.  I'm homesick.  They say that every foreign
officer remembers most clearly the spot where the going was the
roughest.  I remember Africa ten times more often than I do the
glamorous nights in Vienna.

But as soon as he said this, he recalled those wonderful nights in the
Austrian capital and that glorious opera hall, romantic in its wartime
near-ruin, resplendent in its postwar resurrection, where the great
singers of the world gave performances of Die Meistersinger, Lohengrin
and Aida: that was living, with celebrations at Demel's and the
Bristol.  What glorious variety I've had.  Suicide bombers at Okinawa
to test whether I was a man or not.  The tour in Africa to prove that I
could run an isolated mission, and Vienna to prove that I could operate
a full-scale embassy, too.

Tears came to his eyes as he remembered the loss of his wife, but
quickly he brushed them away: I'm ashamed of myself.  The doubts this
morning.  The hesitations.  Of course I'm growing older, but for God's
sake, Richard, let's do it with some class.  Get your damned eye
fixed.

Write to your old companions.  Invite that Englishman who behaved so
well in Africa over to visit for a while.  Get on with it, man.  End it
in style.  Remember what the scoutmaster taught you: "Never tie a
granny knot that comes undone.  Tie a square one that can't be pulled
apart by wild horses."

At this point in his wandering he saw that he was close to the spot
where the Emerald Pool nestled among the low trees and shrubs: "They
did leave a few growing things about," and as he approached the spot he
saw that remnants were prospering despite the carnage about them.

As he moved closer to the spot to which he had become attached in his
explorations of the savanna, he became almost afraid of what he would
see: the deterioration of the pool itself, the denuding of the
surrounding landscape, the absence of wildlife, but as he neared it he
saw that something, at least, had been salvaged.  There was the body of
water, still with its emerald cover, and there were a few shrubs about
the edges and a frayed patch of grass.

As he studied the deterioration of what had been a thriving oasis he
thought of the massive changes he had witnessed in his life: the wild
adjustments in the map of Africa, the demise of Communism throughout
the world, the quiet gaining of power by China, the rise of Japan and
Germany as major competitors of the United States, and the sad decline
of our own productive capacity with its concomitant loss of national
leadership.

"It's been a rocky ride," he said aloud, 'but I wouldn't have missed
it."

As his words echoed heavily in the silent air he was heard by a
longtime resident of the area about the pool, and this one took
immediate fright at the unexpected noise.  It was Rattler, who had
found the recent months most disturbing.  He'd been repelled by the big
blue heron when he tried to steal her chicks, and had been repeatedly
attacked by her mate when he tried to retreat.  He had spent weeks
without catching a mouse or a rabbit, and those dreadful machines that
tore up the earth had come perilously close to where he had lived for
so many years of his life.

The various commotions and defeats had put him in an ill temper, so as
he watched this new intrusion with hooded eyes, one of the man things
he had been watching through the years and ignoring if they passed him
by and allowed him to rest, he followed the approaching footsteps with
added care.  In preparation for defense, he twisted himself into a
tight coil from which he could spring with tripled force if he felt he
must attack before the moving object attacked him.  In this posture,
scarcely breathing lest he move a twig that might alert the intruder,
he waited.

Closer and closer came the heavy, steel-toed boots.  It seemed as if
the next steps must strike the area where Rattler waited, and when one
of the huge feet did rise as if it were going to hit the snake, the
snake activated his warning rattles and with a mighty thrust of his
coiled body leaped forward in the air, fangs at the ready and bullet
head directed right at the upper leg of the invader.  In a flash during
which morning sunlight illuminated the long, thick body of the snake,
Rattler's potent fangs sank deeply into the calf just above St.  Pres's
bush shoe, delivered their deadly poison and withdrew.

St.  Pres caught only a fleeting glimpse of the snake as it came flying
at him through the air, but he did see the head strike his leg, and he
was aware that the fangs had plunged deeply and hung there for a long
moment.  And he saw the snake retreat as a strange sensation throbbed
in his leg and seemed to course upward in some artery or vein.

Clutching his left leg and pressing upon the stricken area as if to
limit the effect of the venom, he fell backward upon a matted tuft of
grass growing from a mound that now formed a kind of chair.

"Is this how it's to end?"  he asked himself quietly as he watched the
grasses move slightly as the rattlesnake slithered away, and he had the
courage to answer: "So far from the hospital!  I doubt I'd reach
there."  Then, scientist that he had always been, even if only an
enthusiastic amateur, he reasoned: He seemed very big.  Thick as my
arm.  He must have delivered He did not finish the thought, for the
poison the great snake had injected was already coursing toward the
heart, inducing a faintness as it sped along, blocking the passage of
oxygen.  He knew the attack was fatal, he could feel the numbness
growing throughout his body.  Then he looked away, across the
devastated savanna toward the Palms: "We had a decent life there.  I
hope Zorn's successor and Helen Quade-' A powerful pain overwhelmed him
as the major burden of the poison reached his heart, but he was strong
and in reasonably good condition, so he did not lose consciousness at
once.  Instead, he gripped the area about his heart, steadied himself
and looked northward to where the gulls, frenzied by some newcomer
bringing no food, wheeled in the sky and became Zero fighters over
Okinawa.  The enemy planes exploded and again he saluted, his right arm
so heavy he could barely raise it.

Adjusting his body to alleviate the pain, he suddenly cried a mighty
"Ugh!"  and fell backward toward the watching snake.  Looking up at the
sky, he saw the flash of the medals he had rightly won, and with a last
cry he shouted "Margaret!"  the name of his wife, who had died too
soon.

There was no reason why anyone should have missed the ambassador at
noontime, since residents did not take lunch together, nor was he
expected at any afternoon meetings.  But toward three in the afternoon
Reverend Quade called his room several times to inquire about some
papers he was supposed to give her regarding a scholarship for one of
the waitresses who was applying to Duke University.  When she failed
three times to reach him, she experienced a powerful premonition that
some accident might have occurred, a premonition rooted in unhappy
experience.

In her work at the three levels of care at the Palms she had formed a
habit of looking directly and intensely into the eyes of the residents,
and had discovered that there was a different look in the eyes of those
older people who had begun to resign themselves to the inevitability of
death:

"They seem to flash signals to those who care.  Time's running out.
I've served my enlistment on the battlefields of life and it's time to
make an orderly retreat."  She had noticed that people who sent such
messages were satisfied that their sons had found a secure place for
themselves in life and that their daughters were safely married.  Their
grandchildren were doing moderately well, no drugs or premature
pregnancies, scholarships to the respected colleges.

"I do not see surrender in their eyes," she had told St.  Pres one
evening at the tertulia, 'rather a sense of reassuring completeness.
The race is over, a modest victory has been won."  She realized now
that in the last few days she'd seen such a look in Richard's eyes as
he neared his eightieth birthday, but in his case it was a look of
bewildered resignation, not triumph, and it was her recollection of
that look that now sent her to the main office: "I'm worried about the
ambassador.

He was supposed to call me at three, and there's been no word."

"I'll call again," said the switchboard operator and still no
response.

"Do you want us to look in his room?  He hasn't rung for help."

"No.  That would be intrusive."  A slight blush crept over her composed
face.

"I've no right to be checking on him."  So the forced entry to his room
was not made.

But as she left the main desk she was not at ease.  Richard St.  Pres
had been signaling for help, of that she was convinced, and as she
started inquiring whether anyone had seen him since breakfast she
learned that he had forgone the morning meeting and headed for the
savanna.

"I saw him being bombarded by the gulls when he brought no food," Laura
Oliphant reported, and someone else had seen him striding in the
general direction of the Emerald Pool.

"Did anyone see him come back?"

"No."

She did not confide in the others that she was going to wander through
the savanna in case he might have fallen into some kind of disabling
trouble, but that is what she did, and she, too, had to fight off the
protesting gulls.

Freed of them, she cut across the barren ground that had once been so
filled with growing things and small animals and headed for the Emerald
Pool, recalling the afternoon when Richard had first taken her to see
this secluded gem, green and glistening in sunlight, and the recent
visit when he had proposed to her.  She half expected to see him
sitting on some hummock and either reading or studying the signs of
life still existing about the edges of the pool.

As she drew closer she saw that he was not there and experienced a
sense of dread, for if he had wandered farther afield and was
incapacitated, it might prove difficult to find him.  Then, as she was
about to turn away she saw him-fallen face upward from the slight rise
on which he must have been perched when death came.

She did not cry out, nor did she shrink away in horror.

Methodically, as if he were some stricken child, she bent down, studied
his ashen face and felt for the heart that had long since ceased
functioning.  That he was dead, and had been for some hours, was
obvious, and this realization fixed her to the spot as she contemplated
what to do.

Dinner would be starting in half an hour, the time it would take her to
return to the Palms, and if she burst in with the news that the
ambassador had died, there would be a commotion and a barrage of
questions she could not answer.  But what had he died of?  Heart
failure?  Some massive stroke?  It would never have occurred to her to
examine his legs to see if a snake had struck him; indeed, she was not
aware that Rattler lay coiled nearby watching with hooded eyes as this
new stranger invaded his sanctuary.

The snake was not required to strike again, for Reverend Quade, her
mind at ease as to what she must do, had begun to walk away from the
pool.  Not hurrying and showing no sign of distraction or despair, she
walked solemnly across the barren savanna to the main building, where
residents were already filing into the dining room.  Avoiding them, she
walked casually to Mr.  Krenek's office, greeted him formally, sat down
and started to speak, but a flood of such emotion swept over her, the
pent-up sorrow of having lost a noble friend, that she suddenly burst
into tears.

"Reverend Quade!  What is it?"

She continued sobbing for some moments, then controlled herself and,
placing her right forefinger on her lips to indicate that Krenek must
not react noisily and attract attention, she whispered: "Ambassador St.
Pres, your men will find him at the Emerald Pool."

"Dead?"

"Yes."

"What happened?"

"Natural causes, one supposes."

"You saw him?  You're sure he was dead?"

"At the pool.  They'll find him there."

"And you want us to keep it quiet?  Till the body has been removed?

And the doctors can give us an explanation?"

"Yes.  There's no need to create distress in there," and she motioned
toward the dining room, which was now filled.

"I'll go out myself to fetch him," Krenek said, and before Helen left
the office, two strong workmen arrived to receive instructions: "A sad
task, men.  We have to do it in complete secrecy," and the three set
off for the Emerald Pool.

When Reverend Quade entered the dining room she paused at the door,
studied the tables and said to herself: "These are my flock whom I have
elected to serve till I die."  As she studied the familiar faces she
realized how deeply she loved these serious people who had made their
decisions relating to the last years of their lives.  She wished each
of them well, and many years of contentment.

At that moment it seemed to her that she could hear organ music she had
known long ago.  She was a young missionary in China and had been
dispatched to a small branch church in the hinterlands to conduct a
week of services in a ramshackle building, which contained a fine
German organ.  An elderly Chinese man had taught himself to play the
simple tunes required, and at the end of each service, as she was
leaving the pulpit, he played a splendid piece of music with obvious
enthusiasm.

On the fourth night she lingered to ask him what the refrain was, and
he had handed her a well-worn sheet of music with the heading
"Recessional.

To be played at the close of service."  It bore no publisher's name, no
date at which it was printed nor the name of the composer.  It had no
text, it was just a sheet of music dating far back in the history of
Christianity, but it was a powerful accompaniment to the close of
worship and the filing out of the faithful.

"Recessional," she whispered softly to herself as she studied the
dining room.

"We're all passing slowly, honorably away."

Then her eyes drifted toward the round table in the corner, where the
tertulia was now deprived of its second member.  Whom would they move
into their circle to take the ambassador's place?  Perhaps Maxim
Lewandowski.  But did it have to be another man?

As she moved quietly to join President Armitage and Senator Raborn as
they waited at the round table, she noticed that Ms.  Oliphant was
lecturing somebody about something.  The Mallorys were regaling a table
with a story about their latest evening on the town.

And once again the yogurt machine was on the blink.

James Michener, best-selling authors, has written more than forty books, most recently The Creatures of the Kingdom.  He lives in Austin, Texas.